Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAD2HEL)

DOT Name	C-C motif chemokine 2 (CCL2)
Synonyms	HC11; Monocyte chemoattractant protein 1; Monocyte chemotactic and activating factor; MCAF; Monocyte chemotactic protein 1; MCP-1; Monocyte secretory protein JE; Small-inducible cytokine A2
Gene Name	CCL2
Related Disease	Neural tube defects, susceptibility to ( )
UniProt ID	CCL2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1DOK; 1DOL; 1DOM; 1DON; 1ML0; 2BDN; 2NZ1; 3IFD; 4DN4; 4R8I; 4ZK9; 7SO0; 7XA3; 8FJ0
Pfam ID	PF00048
Sequence	MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
Function	Acts as a ligand for C-C chemokine receptor CCR2. Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions. Exhibits a chemotactic activity for monocytes and basophils but not neutrophils or eosinophils. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis.
Tissue Specificity	Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level) . Expressed in monocytes .
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) Viral protein interaction with cytokine and cytokine receptor (hsa04061 ) Chemokine sig.ling pathway (hsa04062 ) NOD-like receptor sig.ling pathway (hsa04621 ) IL-17 sig.ling pathway (hsa04657 ) TNF sig.ling pathway (hsa04668 ) AGE-RAGE sig.ling pathway in diabetic complications (hsa04933 ) Yersinia infection (hsa05135 ) Chagas disease (hsa05142 ) Malaria (hsa05144 ) Human cytomegalovirus infection (hsa05163 ) Influenza A (hsa05164 ) Herpes simplex virus 1 infection (hsa05168 ) Coro.virus disease - COVID-19 (hsa05171 ) Rheumatoid arthritis (hsa05323 ) Lipid and atherosclerosis (hsa05417 ) Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway	ATF4 activates genes in response to endoplasmic reticulum stress (R-HSA-380994 ) Interleukin-10 signaling (R-HSA-6783783 ) Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 ) NFE2L2 regulating inflammation associated genes (R-HSA-9818026 ) Chemokine receptors bind chemokines (R-HSA-380108 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Neural tube defects, susceptibility to	DISHA84K	No Known	Autosomal dominant	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	C-C motif chemokine 2 (CCL2) increases the response to substance of Paclitaxel.	[71]
------------------------------------------------------------------------------------

88 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of C-C motif chemokine 2 (CCL2).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of C-C motif chemokine 2 (CCL2).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of C-C motif chemokine 2 (CCL2).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of C-C motif chemokine 2 (CCL2).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of C-C motif chemokine 2 (CCL2).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of C-C motif chemokine 2 (CCL2).	[7]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of C-C motif chemokine 2 (CCL2).	[8]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of C-C motif chemokine 2 (CCL2).	[9]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of C-C motif chemokine 2 (CCL2).	[10]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of C-C motif chemokine 2 (CCL2).	[11]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of C-C motif chemokine 2 (CCL2).	[12]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of C-C motif chemokine 2 (CCL2).	[13]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of C-C motif chemokine 2 (CCL2).	[14]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of C-C motif chemokine 2 (CCL2).	[15]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of C-C motif chemokine 2 (CCL2).	[16]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of C-C motif chemokine 2 (CCL2).	[17]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of C-C motif chemokine 2 (CCL2).	[18]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of C-C motif chemokine 2 (CCL2).	[19]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of C-C motif chemokine 2 (CCL2).	[20]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of C-C motif chemokine 2 (CCL2).	[21]
Folic acid	DMEMBJC	Approved	Folic acid increases the expression of C-C motif chemokine 2 (CCL2).	[22]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of C-C motif chemokine 2 (CCL2).	[23]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of C-C motif chemokine 2 (CCL2).	[24]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of C-C motif chemokine 2 (CCL2).	[25]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of C-C motif chemokine 2 (CCL2).	[27]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of C-C motif chemokine 2 (CCL2).	[28]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate decreases the expression of C-C motif chemokine 2 (CCL2).	[29]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the activity of C-C motif chemokine 2 (CCL2).	[30]
DTI-015	DMXZRW0	Approved	DTI-015 increases the expression of C-C motif chemokine 2 (CCL2).	[31]
Mitomycin	DMH0ZJE	Approved	Mitomycin increases the expression of C-C motif chemokine 2 (CCL2).	[32]
Simvastatin	DM30SGU	Approved	Simvastatin decreases the expression of C-C motif chemokine 2 (CCL2).	[34]
Gemcitabine	DMSE3I7	Approved	Gemcitabine decreases the expression of C-C motif chemokine 2 (CCL2).	[35]
Zidovudine	DM4KI7O	Approved	Zidovudine increases the expression of C-C motif chemokine 2 (CCL2).	[36]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of C-C motif chemokine 2 (CCL2).	[37]
Daunorubicin	DMQUSBT	Approved	Daunorubicin decreases the expression of C-C motif chemokine 2 (CCL2).	[38]
Thalidomide	DM70BU5	Approved	Thalidomide decreases the expression of C-C motif chemokine 2 (CCL2).	[39]
Prednisolone	DMQ8FR2	Approved	Prednisolone decreases the expression of C-C motif chemokine 2 (CCL2).	[38]
Vitamin C	DMXJ7O8	Approved	Vitamin C affects the expression of C-C motif chemokine 2 (CCL2).	[40]
Ursodeoxycholic acid	DMCUT21	Approved	Ursodeoxycholic acid increases the expression of C-C motif chemokine 2 (CCL2).	[41]
Hydrocortisone	DMGEMB7	Approved	Hydrocortisone decreases the expression of C-C motif chemokine 2 (CCL2).	[38]
Rofecoxib	DM3P5DA	Approved	Rofecoxib increases the expression of C-C motif chemokine 2 (CCL2).	[37]
Ritonavir	DMU764S	Approved	Ritonavir increases the expression of C-C motif chemokine 2 (CCL2).	[36]
Dinoprostone	DMTYOPD	Approved	Dinoprostone decreases the expression of C-C motif chemokine 2 (CCL2).	[43]
Vitamin A	DMJ2AH4	Approved	Vitamin A decreases the expression of C-C motif chemokine 2 (CCL2).	[44]
Atazanavir	DMSYRBX	Approved	Atazanavir increases the expression of C-C motif chemokine 2 (CCL2).	[36]
Tofacitinib	DMBS370	Approved	Tofacitinib decreases the expression of C-C motif chemokine 2 (CCL2).	[45]
Methimazole	DM25FL8	Approved	Methimazole increases the expression of C-C motif chemokine 2 (CCL2).	[9]
Mebendazole	DMO14SG	Approved	Mebendazole increases the expression of C-C motif chemokine 2 (CCL2).	[38]
Fructose	DM43AN2	Approved	Fructose increases the expression of C-C motif chemokine 2 (CCL2).	[46]
Sodium chloride	DMM3950	Approved	Sodium chloride increases the expression of C-C motif chemokine 2 (CCL2).	[47]
Nelfinavir mesylate	DMFX6G8	Approved	Nelfinavir mesylate increases the expression of C-C motif chemokine 2 (CCL2).	[36]
Vitamin B3	DMQVRZH	Approved	Vitamin B3 decreases the expression of C-C motif chemokine 2 (CCL2).	[48]
Nicotinamide	DMUPE07	Approved	Nicotinamide decreases the expression of C-C motif chemokine 2 (CCL2).	[50]
Allopurinol	DMLPAOB	Approved	Allopurinol increases the expression of C-C motif chemokine 2 (CCL2).	[51]
Hydroxychloroquine	DMSIVND	Approved	Hydroxychloroquine increases the expression of C-C motif chemokine 2 (CCL2).	[52]
Budesonide	DMJIBAW	Approved	Budesonide decreases the expression of C-C motif chemokine 2 (CCL2).	[38]
Polyethylene glycol	DM4I1JP	Approved	Polyethylene glycol increases the expression of C-C motif chemokine 2 (CCL2).	[54]
Vemurafenib	DM62UG5	Approved	Vemurafenib increases the expression of C-C motif chemokine 2 (CCL2).	[55]
Propylthiouracil	DM6D7N8	Approved	Propylthiouracil decreases the expression of C-C motif chemokine 2 (CCL2).	[9]
Stavudine	DM6DEK9	Approved	Stavudine increases the expression of C-C motif chemokine 2 (CCL2).	[36]
Indinavir	DM0T3YH	Approved	Indinavir increases the expression of C-C motif chemokine 2 (CCL2).	[36]
Emetine	DMCT2YF	Approved	Emetine decreases the expression of C-C motif chemokine 2 (CCL2).	[38]
Probenecid	DMMFWOJ	Approved	Probenecid increases the expression of C-C motif chemokine 2 (CCL2).	[28]
Digoxin	DMQCTIH	Approved	Digoxin decreases the expression of C-C motif chemokine 2 (CCL2).	[38]
Fludrocortisone	DMUDIR8	Approved	Fludrocortisone decreases the expression of C-C motif chemokine 2 (CCL2).	[38]
Lopinavir	DMITQS0	Approved	Lopinavir increases the expression of C-C motif chemokine 2 (CCL2).	[36]
Perindopril	DMOPZDT	Approved	Perindopril decreases the expression of C-C motif chemokine 2 (CCL2).	[57]
Cenestin	DMXQS7K	Approved	Cenestin decreases the expression of C-C motif chemokine 2 (CCL2).	[59]
Febuxostat	DMDEXQ0	Approved	Febuxostat increases the expression of C-C motif chemokine 2 (CCL2).	[51]
Albendazole	DMYZ57N	Approved	Albendazole increases the expression of C-C motif chemokine 2 (CCL2).	[38]
Tecfidera	DM2OVDT	Approved	Tecfidera decreases the expression of C-C motif chemokine 2 (CCL2).	[60]
Betamethasone	DMAHJEF	Approved	Betamethasone decreases the expression of C-C motif chemokine 2 (CCL2).	[38]
Angiotensin Ii	DMLWQ27	Approved	Angiotensin Ii increases the expression of C-C motif chemokine 2 (CCL2).	[61]
Oxytetracycline	DMOVH1M	Approved	Oxytetracycline decreases the expression of C-C motif chemokine 2 (CCL2).	[38]
Triamcinolone	DM98IXF	Approved	Triamcinolone decreases the expression of C-C motif chemokine 2 (CCL2).	[38]
Bisoprolol	DM3UZ95	Approved	Bisoprolol decreases the expression of C-C motif chemokine 2 (CCL2).	[57]
Amprenavir	DMLMXE0	Approved	Amprenavir increases the expression of C-C motif chemokine 2 (CCL2).	[36]
Meclocycline	DMSFQ8I	Approved	Meclocycline decreases the expression of C-C motif chemokine 2 (CCL2).	[38]
Epoprostenol	DMUTYR2	Approved	Epoprostenol increases the expression of C-C motif chemokine 2 (CCL2).	[63]
Beclomethasone dipropionate	DM5NW1E	Phase 4	Beclomethasone dipropionate decreases the expression of C-C motif chemokine 2 (CCL2).	[38]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of C-C motif chemokine 2 (CCL2).	[66]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of C-C motif chemokine 2 (CCL2).	[67]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of C-C motif chemokine 2 (CCL2).	[69]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin decreases the expression of C-C motif chemokine 2 (CCL2).	[38]
Atorvastatin	DMF28YC	Phase 3 Trial	Atorvastatin decreases the expression of C-C motif chemokine 2 (CCL2).	[34]
HMPL-004	DM29XGY	Phase 3	HMPL-004 increases the expression of C-C motif chemokine 2 (CCL2).	[70]
Bardoxolone methyl	DMODA2X	Phase 3	Bardoxolone methyl increases the expression of C-C motif chemokine 2 (CCL2).	[70]
Chloroquine	DMSI5CB	Phase 3 Trial	Chloroquine increases the expression of C-C motif chemokine 2 (CCL2).	[52]
------------------------------------------------------------------------------------


⏷ Show the Full List of 88 Drug(s)

12 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the secretion of C-C motif chemokine 2 (CCL2).	[26]
Cocaine	DMSOX7I	Approved	Cocaine increases the secretion of C-C motif chemokine 2 (CCL2).	[33]
Gefitinib	DM15F0X	Approved	Gefitinib increases the secretion of C-C motif chemokine 2 (CCL2).	[42]
Efavirenz	DMC0GSJ	Approved	Efavirenz increases the secretion of C-C motif chemokine 2 (CCL2).	[49]
Pomalidomide	DMTGBAX	Approved	Pomalidomide increases the secretion of C-C motif chemokine 2 (CCL2).	[53]
Imiquimod	DM1TMA3	Approved	Imiquimod increases the secretion of C-C motif chemokine 2 (CCL2).	[56]
Dextromethorphan	DMUDJZM	Approved	Dextromethorphan increases the secretion of C-C motif chemokine 2 (CCL2).	[58]
Sulfapyridine	DMIUYFH	Approved	Sulfapyridine decreases the secretion of C-C motif chemokine 2 (CCL2).	[62]
Codeine	DMJX6ZG	Approved	Codeine increases the secretion of C-C motif chemokine 2 (CCL2).	[64]
Chondroitin sulfate	DM0N19Y	Phase 4	Chondroitin sulfate affects the binding of C-C motif chemokine 2 (CCL2).	[65]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the secretion of C-C motif chemokine 2 (CCL2).	[68]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the secretion of C-C motif chemokine 2 (CCL2).	[68]
------------------------------------------------------------------------------------


⏷ Show the Full List of 12 Drug(s)

References

1	Maternal genotype for the monocyte chemoattractant protein 1 A(-2518)G promoter polymorphism is associated with the risk of spina bifida in offspring. Am J Med Genet A. 2006 May 15;140(10):1114-8. doi: 10.1002/ajmg.a.31212.
2	From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
3	Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
4	Retinoic acid-induced downmodulation of telomerase activity in human cancer cells. Exp Mol Pathol. 2005 Oct;79(2):108-17.
5	Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
6	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7	Copper induces--and copper chelation by tetrathiomolybdate inhibits--endothelial activation in vitro. Redox Rep. 2014 Jan;19(1):40-8. doi: 10.1179/1351000213Y.0000000070. Epub 2013 Nov 12.
8	Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
9	Monitoring of deiodinase deficiency based on transcriptomic responses in SH-SY5Y cells. Arch Toxicol. 2013 Jun;87(6):1103-13. doi: 10.1007/s00204-013-1018-4. Epub 2013 Feb 10.
10	Gene expression of inflammatory molecules in circulating lymphocytes from arsenic-exposed human subjects. Environ Health Perspect. 2003 Aug;111(11):1429-38. doi: 10.1289/ehp.6396.
11	Plant polyphenols differentially modulate inflammatory responses of human keratinocytes by interfering with activation of transcription factors NFB and AhR and EGFR-ERK pathway. Toxicol Appl Pharmacol. 2011 Sep 1;255(2):138-49.
12	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
13	Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
14	Oxidative Stress Alters miRNA and Gene Expression Profiles in Villous First Trimester Trophoblasts. Biomed Res Int. 2015;2015:257090. doi: 10.1155/2015/257090. Epub 2015 Aug 3.
15	Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
16	A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
17	Altered expression of genes identified in rats with prostatic chronic inflammation in a prostate spheroid model treated by estradiol/testosterone. J Toxicol Sci. 2021;46(11):515-523. doi: 10.2131/jts.46.515.
18	The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
19	Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
20	Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
21	Dexamethasone and the inflammatory response in explants of human omental adipose tissue. Mol Cell Endocrinol. 2010 Feb 5;315(1-2):292-8.
22	The up-regulation of monocyte chemoattractant protein-1 (MCP-1) in Ea.hy 926 endothelial cells under long-term low folate stress is mediated by the p38 MAPK pathway. Atherosclerosis. 2009 Jul;205(1):48-54. doi: 10.1016/j.atherosclerosis.2008.12.008. Epub 2008 Dec 13.
23	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
24	Synergistic antiproliferative effect of arsenic trioxide combined with bortezomib in HL60 cell line and primary blasts from patients affected by myeloproliferative disorders. Cancer Genet Cytogenet. 2010 Jun;199(2):110-20. doi: 10.1016/j.cancergencyto.2010.02.010.
25	Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
26	Hydroquinone-induced apoptosis of human lymphocytes through caspase 9/3 pathway. Mol Biol Rep. 2012 Jun;39(6):6737-43. doi: 10.1007/s11033-012-1498-y.
27	Role of MCP-1 in alcohol-induced aggressiveness of colorectal cancer cells. Mol Carcinog. 2016 May;55(5):1002-11. doi: 10.1002/mc.22343. Epub 2015 May 25.
28	Evaluation and mechanistic analysis of the cytotoxicity of the acyl glucuronide of nonsteroidal anti-inflammatory drugs. Drug Metab Dispos. 2014 Jan;42(1):1-8. doi: 10.1124/dmd.113.054478. Epub 2013 Oct 8.
29	Prediction of the contact sensitizing potential of chemicals using analysis of gene expression changes in human THP-1 monocytes. Toxicol Lett. 2010 Nov 10;199(1):51-9.
30	IL-8 and MCP-1/CCL2 regulate proteolytic activity in triple negative inflammatory breast cancer a mechanism that might be modulated by Src and Erk1/2. Toxicol Appl Pharmacol. 2020 Aug 15;401:115092. doi: 10.1016/j.taap.2020.115092. Epub 2020 Jun 5.
31	Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
32	Dexamethasone reduces mitomycin C-related inflammatory cytokine expression without inducing further cell death in corneal fibroblasts. Wound Repair Regen. 2010 Jan-Feb;18(1):59-69. doi: 10.1111/j.1524-475X.2009.00551.x. Epub 2009 Dec 11.
33	Cocaine opens the blood-brain barrier to HIV-1 invasion. J Neurovirol. 1998 Dec;4(6):619-26. doi: 10.3109/13550289809114228.
34	Simvastatin reduces expression of cytokines interleukin-6, interleukin-8, and monocyte chemoattractant protein-1 in circulating monocytes from hypercholesterolemic patients. Arterioscler Thromb Vasc Biol. 2002 Jul 1;22(7):1194-9. doi: 10.1161/01.atv.0000022694.16328.cc.
35	Metronomic gemcitabine suppresses tumour growth, improves perfusion, and reduces hypoxia in human pancreatic ductal adenocarcinoma. Br J Cancer. 2010 Jun 29;103(1):52-60.
36	Some HIV antiretrovirals increase oxidative stress and alter chemokine, cytokine or adiponectin production in human adipocytes and macrophages. Antivir Ther. 2007;12(4):489-500.
37	Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
38	Cell-based and cytokine-directed chemical screen to identify potential anti-multiple myeloma agents. Leuk Res. 2010 Jul;34(7):917-24. doi: 10.1016/j.leukres.2009.12.002. Epub 2010 Feb 8.
39	Polyunsaturated fatty acids synergize with lipid droplet binding thalidomide analogs to induce oxidative stress in cancer cells. Lipids Health Dis. 2010 Jun 2;9:56. doi: 10.1186/1476-511X-9-56.
40	Pharmacologic concentrations of ascorbic acid cause diverse influence on differential expressions of angiogenic chemokine genes in different hepatocellular carcinoma cell lines. Biomed Pharmacother. 2010 May;64(5):348-51. doi: 10.1016/j.biopha.2009.06.005. Epub 2009 Oct 22.
41	Ursodeoxycholic acid but not tauroursodeoxycholic acid inhibits proliferation and differentiation of human subcutaneous adipocytes. PLoS One. 2013 Dec 3;8(12):e82086. doi: 10.1371/journal.pone.0082086. eCollection 2013.
42	Crosstalk between alveolar macrophages and alveolar epithelial cells/fibroblasts contributes to the pulmonary toxicity of gefitinib. Toxicol Lett. 2021 Mar 1;338:1-9. doi: 10.1016/j.toxlet.2020.11.011. Epub 2020 Nov 25.
43	Maturation of human monocyte-derived dendritic cells (MoDCs) in the presence of prostaglandin E2 optimizes CD4 and CD8 T cell-mediated responses to protein antigens: role of PGE2 in chemokine and cytokine expression by MoDCs. Int Immunol. 2005 Dec;17(12):1561-72. doi: 10.1093/intimm/dxh335. Epub 2005 Nov 22.
44	Vitamin A supplementation reduces the monocyte chemoattractant protein-1 intestinal immune response of Mexican children. J Nutr. 2006 Oct;136(10):2600-5. doi: 10.1093/jn/136.10.2600.
45	The JAK inhibitor tofacitinib suppresses synovial JAK1-STAT signalling in rheumatoid arthritis. Ann Rheum Dis. 2015 Jun;74(6):1311-6. doi: 10.1136/annrheumdis-2014-206028. Epub 2014 Nov 14.
46	Non-nutritional sweeteners effects on endothelial vascular function. Toxicol In Vitro. 2020 Feb;62:104694. doi: 10.1016/j.tiv.2019.104694. Epub 2019 Oct 23.
47	Neoplastic-like transformation effect of single-walled and multi-walled carbon nanotubes compared to asbestos on human lung small airway epithelial cells. Nanotoxicology. 2014 Aug;8(5):485-507.
48	Niacin inhibits vascular oxidative stress, redox-sensitive genes, and monocyte adhesion to human aortic endothelial cells. Atherosclerosis. 2009 Jan;202(1):68-75. doi: 10.1016/j.atherosclerosis.2008.04.044. Epub 2008 May 9.
49	Effects of nevirapine and efavirenz on human adipocyte differentiation, gene expression, and release of adipokines and cytokines. Antiviral Res. 2011 Aug;91(2):112-9. doi: 10.1016/j.antiviral.2011.04.018. Epub 2011 May 17.
50	Nicotinamide inhibits tissue factor expression in isolated human pancreatic islets: implications for clinical islet transplantation. Transplantation. 2003 Nov 15;76(9):1285-8. doi: 10.1097/01.TP.0000098905.86445.0F.
51	Allopurinol induces innate immune responses through mitogen-activated protein kinase signaling pathways in HL-60 cells. J Appl Toxicol. 2016 Sep;36(9):1120-8. doi: 10.1002/jat.3272. Epub 2015 Dec 7.
52	Reactive oxygen species mediate chloroquine-induced expression of chemokines by human astroglial cells. Glia. 2004 Jul;47(1):9-20. doi: 10.1002/glia.20017.
53	Immunomodulatory derivative of thalidomide (IMiD CC-4047) induces a shift in lineage commitment by suppressing erythropoiesis and promoting myelopoiesis. Blood. 2005 May 15;105(10):3833-40. doi: 10.1182/blood-2004-03-0828. Epub 2004 Aug 3.
54	Vanin-1: a potential biomarker for nephrotoxicant-induced renal injury. Toxicology. 2011 Nov 28;290(1):82-8. doi: 10.1016/j.tox.2011.08.019. Epub 2011 Sep 3.
55	Overcoming melanoma resistance to vemurafenib by targeting CCL2-induced miR-34a, miR-100 and miR-125b. Oncotarget. 2016 Jan 26;7(4):4428-41. doi: 10.18632/oncotarget.6599.
56	Cannabidiol selectively modulates interleukin (IL)-1 and IL-6 production in toll-like receptor activated human peripheral blood monocytes. Toxicology. 2021 Dec;464:153016. doi: 10.1016/j.tox.2021.153016. Epub 2021 Nov 2.
57	The effects of 1 month antihypertensive treatment with perindopril, bisoprolol or both on the ex vivo ability of monocytes to secrete inflammatory cytokines. Int J Clin Pharmacol Ther. 2009 Nov;47(11):686-94. doi: 10.5414/cpp47686.
58	Dextromethorphan - A widely-used cough suppressant - Induces local anaphylaxis via MRGPRX2 on mast cells. Chem Biol Interact. 2020 Oct 1;330:109248. doi: 10.1016/j.cbi.2020.109248. Epub 2020 Aug 29.
59	Circulating chemoattractants RANTES, negatively related to endogenous androgens, and MCP-1 are differentially suppressed by hormone therapy and raloxifene. Atherosclerosis. 2007 Jul;193(1):142-50. doi: 10.1016/j.atherosclerosis.2006.05.045. Epub 2006 Jul 13.
60	Dimethyl Fumarate Inhibits the Nuclear Factor B Pathway in Breast Cancer Cells by Covalent Modification of p65 Protein. J Biol Chem. 2016 Feb 12;291(7):3639-47. doi: 10.1074/jbc.M115.679704. Epub 2015 Dec 18.
61	Uncovering the mechanism of Naoxintong capsule against hypertension based on network analysis and in?vitro experiments. Chem Biol Drug Des. 2024 Jan;103(1):e14440. doi: 10.1111/cbdd.14440.
62	The effect of sulfasalazine on rheumatoid arthritic synovial tissue chemokine production. Exp Mol Pathol. 2002 Oct;73(2):84-92. doi: 10.1006/exmp.2002.2460.
63	Soluble CD40 ligand in pulmonary arterial hypertension: possible pathogenic role of the interaction between platelets and endothelial cells. Circulation. 2004 Aug 24;110(8):999-1005. doi: 10.1161/01.CIR.0000139859.68513.FC. Epub 2004 Aug 9.
64	Codeine induces human mast cell chemokine and cytokine production: involvement of G-protein activation. Allergy. 2007 May;62(5):532-8. doi: 10.1111/j.1398-9995.2007.01345.x.
65	Monocyte chemoattractant protein 1 released from glycosaminoglycans mediates its profibrotic effects in systemic sclerosis via the release of interleukin-4 from T cells. Arthritis Rheum. 2006 Jan;54(1):214-25. doi: 10.1002/art.21497.
66	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
67	Antioxidant and signal modulation properties of plant polyphenols in controlling vascular inflammation. Eur J Pharmacol. 2011 May 11;658(2-3):248-56.
68	Anti-inflammatory effects of dietary phenolic compounds in an in vitro model of inflamed human intestinal epithelium. Chem Biol Interact. 2010 Dec 5;188(3):659-67.
69	Gene-expression profiling during curcumin-induced apoptosis reveals downregulation of CXCR4. Exp Hematol. 2007 Jan;35(1):84-95.
70	Mapping the dynamics of Nrf2 antioxidant and NFB inflammatory responses by soft electrophilic chemicals in human liver cells defines the transition from adaptive to adverse responses. Toxicol In Vitro. 2022 Oct;84:105419. doi: 10.1016/j.tiv.2022.105419. Epub 2022 Jun 17.
71	CCL2 expression in primary ovarian carcinoma is correlated with chemotherapy response and survival outcomes. Anticancer Res. 2010 Dec;30(12):4791-8.