General Information of Drug Off-Target (DOT) (ID: OTB73XXA)

DOT Name Pleckstrin (PLEK)
Synonyms Platelet 47 kDa protein; p47
Gene Name PLEK
Related Disease
Episodic kinesigenic dyskinesia 1 ( )
Aarskog-Scott syndrome, X-linked ( )
Adult glioblastoma ( )
Adult T-cell leukemia/lymphoma ( )
Advanced cancer ( )
Age-related macular degeneration ( )
Alzheimer disease ( )
Bruton-type agammaglobulinemia ( )
Centronuclear myopathy ( )
Charcot marie tooth disease ( )
Chronic granulomatous disease ( )
Coeliac disease ( )
Endometrial carcinoma ( )
Esophageal squamous cell carcinoma ( )
Familial adenomatous polyposis ( )
Glioma ( )
Human T-lymphotropic virus 1 infectious disease ( )
Hyperlipidemia ( )
Immunodeficiency ( )
Leukemia ( )
Lung cancer ( )
Multiple sclerosis ( )
Obstructive sleep apnea ( )
Osteoporosis ( )
Pancreatic cancer ( )
Rheumatoid arthritis ( )
Thrombocytopenia ( )
Transitional cell carcinoma ( )
Urothelial carcinoma ( )
Vascular dementia ( )
Venous thromboembolism ( )
Vibrio cholerae infection ( )
Asthma ( )
Autoimmune disease ( )
Breast cancer ( )
Breast carcinoma ( )
Hirschsprung disease ( )
Immune system disorder ( )
Melanoma ( )
Periodontitis ( )
Glioblastoma multiforme ( )
Malaria ( )
Neoplasm ( )
Non-insulin dependent diabetes ( )
Obesity ( )
Parkinson disease ( )
T-cell leukaemia ( )
Type-1 diabetes ( )
Type-1/2 diabetes ( )
UniProt ID
PLEK_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1PLS; 1W4M; 1X05; 1XX0; 1ZM0; 2CSO; 2I5C; 2I5F
Pfam ID
PF00610 ; PF00169
Sequence
MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQ
DFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRL
PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMI
ASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEE
FRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSV
ESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIRAIQMASRTGK
Function Major protein kinase C substrate of platelets.
Reactome Pathway
Platelet degranulation (R-HSA-114608 )

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Episodic kinesigenic dyskinesia 1 DISGVQMP Definitive Biomarker [1]
Aarskog-Scott syndrome, X-linked DISNHV62 Strong Genetic Variation [2]
Adult glioblastoma DISVP4LU Strong Genetic Variation [3]
Adult T-cell leukemia/lymphoma DIS882XU Strong Altered Expression [4]
Advanced cancer DISAT1Z9 Strong Biomarker [5]
Age-related macular degeneration DIS0XS2C Strong Genetic Variation [6]
Alzheimer disease DISF8S70 Strong Biomarker [7]
Bruton-type agammaglobulinemia DISQ5ZYP Strong Genetic Variation [8]
Centronuclear myopathy DISXBEJO Strong Genetic Variation [9]
Charcot marie tooth disease DIS3BT2L Strong Genetic Variation [10]
Chronic granulomatous disease DIS9ZR24 Strong Genetic Variation [11]
Coeliac disease DISIY60C Strong Genetic Variation [12]
Endometrial carcinoma DISXR5CY Strong Genetic Variation [13]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [14]
Familial adenomatous polyposis DISW53RE Strong Biomarker [15]
Glioma DIS5RPEH Strong Biomarker [16]
Human T-lymphotropic virus 1 infectious disease DISN5C4M Strong Biomarker [4]
Hyperlipidemia DIS61J3S Strong Biomarker [17]
Immunodeficiency DIS093I0 Strong Biomarker [18]
Leukemia DISNAKFL Strong Genetic Variation [19]
Lung cancer DISCM4YA Strong Genetic Variation [20]
Multiple sclerosis DISB2WZI Strong Genetic Variation [21]
Obstructive sleep apnea DIS0SVD1 Strong Genetic Variation [22]
Osteoporosis DISF2JE0 Strong Biomarker [23]
Pancreatic cancer DISJC981 Strong Genetic Variation [24]
Rheumatoid arthritis DISTSB4J Strong Biomarker [25]
Thrombocytopenia DISU61YW Strong Biomarker [26]
Transitional cell carcinoma DISWVVDR Strong Genetic Variation [27]
Urothelial carcinoma DISRTNTN Strong Genetic Variation [27]
Vascular dementia DISVO82H Strong Biomarker [28]
Venous thromboembolism DISUR7CR Strong Genetic Variation [29]
Vibrio cholerae infection DISW7E3U Strong Biomarker [30]
Asthma DISW9QNS moderate Altered Expression [31]
Autoimmune disease DISORMTM moderate Genetic Variation [32]
Breast cancer DIS7DPX1 moderate Biomarker [33]
Breast carcinoma DIS2UE88 moderate Biomarker [33]
Hirschsprung disease DISUUSM1 moderate Biomarker [34]
Immune system disorder DISAEGPH moderate Genetic Variation [32]
Melanoma DIS1RRCY moderate Posttranslational Modification [35]
Periodontitis DISI9JOI moderate Altered Expression [36]
Glioblastoma multiforme DISK8246 Disputed Genetic Variation [3]
Malaria DISQ9Y50 Limited Biomarker [37]
Neoplasm DISZKGEW Limited Genetic Variation [38]
Non-insulin dependent diabetes DISK1O5Z Limited Biomarker [39]
Obesity DIS47Y1K Limited Biomarker [39]
Parkinson disease DISQVHKL Limited Genetic Variation [40]
T-cell leukaemia DISJ6YIF Limited Biomarker [41]
Type-1 diabetes DIS7HLUB Limited Biomarker [42]
Type-1/2 diabetes DISIUHAP Limited Altered Expression [43]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Pleckstrin (PLEK). [44]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Pleckstrin (PLEK). [45]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Pleckstrin (PLEK). [46]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Pleckstrin (PLEK). [47]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Pleckstrin (PLEK). [48]
Pioglitazone DMKJ485 Approved Pioglitazone decreases the expression of Pleckstrin (PLEK). [49]
Tamibarotene DM3G74J Phase 3 Tamibarotene increases the expression of Pleckstrin (PLEK). [44]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Pleckstrin (PLEK). [51]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Pleckstrin (PLEK). [52]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the phosphorylation of Pleckstrin (PLEK). [50]
5'-Guanosine-Diphosphate-Monothiophosphate DMIARG7 Investigative 5'-Guanosine-Diphosphate-Monothiophosphate increases the phosphorylation of Pleckstrin (PLEK). [50]
------------------------------------------------------------------------------------

References

1 Proline-rich transmembrane protein 2-negative paroxysmal kinesigenic dyskinesia: Clinical and genetic analyses of 163 patients.Mov Disord. 2018 Mar;33(3):459-467. doi: 10.1002/mds.27274. Epub 2018 Jan 22.
2 Novel variant in the FGD1 gene causing Aarskog-Scott syndrome.Exp Ther Med. 2017 Jun;13(6):2623-2628. doi: 10.3892/etm.2017.4301. Epub 2017 Apr 5.
3 Mislocalization of the E3 ligase, -transducin repeat-containing protein 1 (-TrCP1), in glioblastoma uncouples negative feedback between the pleckstrin homology domain leucine-rich repeat protein phosphatase 1 (PHLPP1) and Akt.J Biol Chem. 2011 Jun 3;286(22):19777-88. doi: 10.1074/jbc.M111.237081. Epub 2011 Mar 28.
4 Degradation of p47 by autophagy contributes to CADM1 overexpression in ATLL cells through the activation of NF-B.Sci Rep. 2019 Mar 5;9(1):3491. doi: 10.1038/s41598-019-39424-7.
5 Pleckstrin homology domain-containing protein PHLDB3 supports cancer growth via a negative feedback loop involving p53. Nat Commun. 2016 Dec 23;7:13755.
6 PLEKHA1-LOC387715-HTRA1 polymorphisms and exudative age-related macular degeneration in the French population.Mol Vis. 2007 Nov 26;13:2153-9.
7 Evidence that the rab5 effector APPL1 mediates APP-CTF-induced dysfunction of endosomes in Down syndrome and Alzheimer's disease.Mol Psychiatry. 2016 May;21(5):707-16. doi: 10.1038/mp.2015.97. Epub 2015 Jul 21.
8 Conservation and covariance in PH domain sequences: physicochemical profile and information theoretical analysis of XLA-causing mutations in the Btk PH domain.Protein Eng Des Sel. 2004 Mar;17(3):267-76. doi: 10.1093/protein/gzh030. Epub 2004 Apr 13.
9 Adult course in dynamin 2 dominant centronuclear myopathy with neonatal onset.Neuromuscul Disord. 2010 Jan;20(1):53-6. doi: 10.1016/j.nmd.2009.10.006. Epub 2009 Nov 22.
10 Centronuclear myopathy with cataracts due to a novel dynamin 2 (DNM2) mutation.Neuromuscul Disord. 2010 Jan;20(1):49-52. doi: 10.1016/j.nmd.2009.10.005. Epub 2009 Nov 22.
11 Aberrant [correction of Abberant] cytosolic calcium ion mobilization in chronic granulomatous disease neutrophils.Inflammation. 2004 Jun;28(3):133-8. doi: 10.1023/b:ifla.0000039559.96659.d9.
12 Multiple common variants for celiac disease influencing immune gene expression.Nat Genet. 2010 Apr;42(4):295-302. doi: 10.1038/ng.543. Epub 2010 Feb 28.
13 AKT1 pleckstrin homology domain E17K activating mutation in endometrial carcinoma.Gynecol Oncol. 2010 Jan;116(1):88-91. doi: 10.1016/j.ygyno.2009.09.038. Epub 2009 Oct 22.
14 MiR-141-3p is upregulated in esophageal squamous cell carcinoma and targets pleckstrin homology domain leucine-rich repeat protein phosphatase-2, a negative regulator of the PI3K/AKT pathway.Biochem Biophys Res Commun. 2018 Jun 22;501(2):507-513. doi: 10.1016/j.bbrc.2018.05.025. Epub 2018 May 16.
15 Identification and characterization of Asef2, a guanine-nucleotide exchange factor specific for Rac1 and Cdc42.Oncogene. 2007 Dec 6;26(55):7620-267. doi: 10.1038/sj.onc.1210574. Epub 2007 Jun 18.
16 Genomically amplified Akt3 activates DNA repair pathway and promotes glioma progression.Proc Natl Acad Sci U S A. 2015 Mar 17;112(11):3421-6. doi: 10.1073/pnas.1414573112. Epub 2015 Mar 3.
17 Increased intracellular Ca(2+) concentrations prevent membrane localization of PH domains through the formation of Ca(2+)-phosphoinositides.Proc Natl Acad Sci U S A. 2017 Nov 7;114(45):11926-11931. doi: 10.1073/pnas.1706489114. Epub 2017 Oct 25.
18 p47 licenses activation of the immune deficiency pathway in the tick Ixodes scapularis.Proc Natl Acad Sci U S A. 2019 Jan 2;116(1):205-210. doi: 10.1073/pnas.1808905116. Epub 2018 Dec 17.
19 PI3K/AKT pathway activation in acute myeloid leukaemias is not associated with AKT1 pleckstrin homology domain mutation.Br J Haematol. 2008 Feb;140(3):344-7. doi: 10.1111/j.1365-2141.2007.06920.x. Epub 2007 Dec 5.
20 AKT1EK Is Oncogenic in Mouse Lung and Cooperates with Chemical Carcinogens in Inducing Lung Cancer.PLoS One. 2016 Feb 9;11(2):e0147334. doi: 10.1371/journal.pone.0147334. eCollection 2016.
21 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.Ann Neurol. 2011 Dec;70(6):897-912. doi: 10.1002/ana.22609.
22 Association of genetic loci with sleep apnea in European Americans and African-Americans: the Candidate Gene Association Resource (CARe).PLoS One. 2012;7(11):e48836. doi: 10.1371/journal.pone.0048836. Epub 2012 Nov 14.
23 Proteomic analysis of circulating monocytes in Chinese premenopausal females with extremely discordant bone mineral density.Proteomics. 2008 Oct;8(20):4259-72. doi: 10.1002/pmic.200700480.
24 AKT1 (E17K) mutation in pancreatic cancer.Technol Cancer Res Treat. 2008 Oct;7(5):407-8. doi: 10.1177/153303460800700509.
25 From transcriptome to proteome: differentially expressed proteins identified in synovial tissue of patients suffering from rheumatoid arthritis and osteoarthritis by an initial screen with a panel of 791 antibodies.Proteomics. 2003 Jun;3(6):991-1002. doi: 10.1002/pmic.200300412.
26 Platelet protein kinase C-theta deficiency with human RUNX1 mutation: PRKCQ is a transcriptional target of RUNX1.Arterioscler Thromb Vasc Biol. 2011 Apr;31(4):921-7. doi: 10.1161/ATVBAHA.110.221879. Epub 2011 Jan 20.
27 AKT1 E17 K pleckstrin homology domain mutation in urothelial carcinoma.Cancer Genet Cytogenet. 2009 May;191(1):34-7. doi: 10.1016/j.cancergencyto.2009.01.009.
28 Functions of intronic nucleotide variants in the gene encoding pleckstrin homology like domain beta 2 (PHLDB2) on susceptibility to vascular dementia.World J Biol Psychiatry. 2013 Apr;14(3):227-32. doi: 10.3109/15622975.2011.630407. Epub 2011 Nov 23.
29 Genomic and transcriptomic association studies identify 16 novel susceptibility loci for venous thromboembolism.Blood. 2019 Nov 7;134(19):1645-1657. doi: 10.1182/blood.2019000435.
30 A Recombinant 47-kDa Outer Membrane Protein Induces an Immune Response against Orientia tsutsugamushi Strain Boryong.Am J Trop Med Hyg. 2017 Jul;97(1):30-37. doi: 10.4269/ajtmh.15-0771.
31 CaMKII is essential for the proasthmatic effects of oxidation.Sci Transl Med. 2013 Jul 24;5(195):195ra97. doi: 10.1126/scitranslmed.3006135.
32 Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.PLoS Genet. 2011 Feb;7(2):e1002004. doi: 10.1371/journal.pgen.1002004. Epub 2011 Feb 24.
33 Novel inhibitors induce large conformational changes of GAB1 pleckstrin homology domain and kill breast cancer cells.PLoS Comput Biol. 2015 Jan 8;11(1):e1004021. doi: 10.1371/journal.pcbi.1004021. eCollection 2015 Jan.
34 Genomic structure of the gene for the SH2 and pleckstrin homology domain-containing protein GRB10 and evaluation of its role in Hirschsprung disease.Oncogene. 1998 Dec 10;17(23):3065-70. doi: 10.1038/sj.onc.1202226.
35 Oncogenic suppression of PHLPP1 in human melanoma.Oncogene. 2014 Sep 25;33(39):4756-66. doi: 10.1038/onc.2013.420. Epub 2013 Oct 14.
36 Transcriptome analysis reveals mucin 4 to be highly associated with periodontitis and identifies pleckstrin as a link to systemic diseases.Sci Rep. 2015 Dec 21;5:18475. doi: 10.1038/srep18475.
37 Plasmodium P47: a key gene for malaria transmission by mosquito vectors.Curr Opin Microbiol. 2017 Dec;40:168-174. doi: 10.1016/j.mib.2017.11.029. Epub 2017 Dec 8.
38 An Inhibitor of the Pleckstrin Homology Domain of CNK1 Selectively Blocks the Growth of Mutant KRAS Cells and Tumors.Cancer Res. 2019 Jun 15;79(12):3100-3111. doi: 10.1158/0008-5472.CAN-18-2372. Epub 2019 Apr 30.
39 Increased abundance of the adaptor protein containing pleckstrin homology domain, phosphotyrosine binding domain and leucine zipper motif (APPL1) in patients with obesity and type 2 diabetes: evidence for altered adiponectin signalling.Diabetologia. 2011 Aug;54(8):2122-31. doi: 10.1007/s00125-011-2173-x. Epub 2011 May 12.
40 Age and -synuclein expression interact to reveal a dependence of dopaminergic axons on endogenous Akt/PKB signaling.Neurobiol Dis. 2011 Nov;44(2):215-22. doi: 10.1016/j.nbd.2011.07.003. Epub 2011 Jul 18.
41 Proto-oncogene TCL1: more than just a coactivator for Akt.FASEB J. 2007 Aug;21(10):2273-84. doi: 10.1096/fj.06-7684com. Epub 2007 Mar 14.
42 APPL1 prevents pancreatic beta cell death and inflammation by dampening NFB activation in a mouse model of type 1 diabetes.Diabetologia. 2017 Mar;60(3):464-474. doi: 10.1007/s00125-016-4185-z. Epub 2016 Dec 23.
43 Euterpe oleracea Mart. seed extract protects against renal injury in diabetic and spontaneously hypertensive rats: role of inflammation and oxidative stress.Eur J Nutr. 2018 Mar;57(2):817-832. doi: 10.1007/s00394-016-1371-1. Epub 2017 Jan 20.
44 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
45 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
46 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
47 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
48 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
49 Peroxisome proliferator activated receptor gamma (PPAR-gama) ligand pioglitazone regulated gene networks in term human primary trophoblast cells. Reprod Toxicol. 2018 Oct;81:99-107.
50 Phospholipase activation and secretion: evidence that PLA2, PLC, and PLD are not essential to exocytosis. Am J Physiol. 1996 Apr;270(4 Pt 1):C1153-63. doi: 10.1152/ajpcell.1996.270.4.C1153.
51 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
52 Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.