Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC7AFHT)

DOT Name Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1)
Synonyms AHA1; p38
Gene Name AHSA1
Related Disease
Lung cancer ( )
Lung carcinoma ( )
Advanced cancer ( )
Alzheimer disease ( )
Arteriosclerosis ( )
Arthritis ( )
Atherosclerosis ( )
B-cell neoplasm ( )
Breast cancer ( )
Breast carcinoma ( )
Chronic obstructive pulmonary disease ( )
Colon cancer ( )
Colon carcinoma ( )
Congestive heart failure ( )
Diabetic kidney disease ( )
Endometriosis ( )
Glioma ( )
Head-neck squamous cell carcinoma ( )
Hepatocellular carcinoma ( )
Hyperglycemia ( )
Melanoma ( )
Myelodysplastic syndrome ( )
Myocardial infarction ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Obesity ( )
Osteoarthritis ( )
Parkinson disease ( )
Plasma cell myeloma ( )
Pneumonia ( )
Pneumonitis ( )
Prostate cancer ( )
Prostate carcinoma ( )
Retinoblastoma ( )
Rheumatoid arthritis ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Cardiac failure ( )
Colorectal carcinoma ( )
leukaemia ( )
Leukemia ( )
Lung adenocarcinoma ( )
Nervous system inflammation ( )
Neuralgia ( )
Non-insulin dependent diabetes ( )
Pancreatic cancer ( )
Tuberculosis ( )
Neuroblastoma ( )
Type-1/2 diabetes ( )
UniProt ID
AHSA1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1X53; 7DMD; 7DME
Pfam ID
PF09229 ; PF08327
Sequence
MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTE
VSKLDGEASINNRKGKLIFFYEWSVKLNWTGTSKSGVQYKGHVEIPNLSDENSVDEVEIS
VSLAKDEPDTNLVALMKEEGVKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPA
LKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPA
TLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETEL
CMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF
Function
Acts as a co-chaperone of HSP90AA1. Activates the ATPase activity of HSP90AA1 leading to increase in its chaperone activity. Competes with the inhibitory co-chaperone FNIP1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins. Competes with the inhibitory co-chaperone TSC1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins.
Tissue Specificity Expressed in numerous tissues, including brain, heart, skeletal muscle and kidney and, at lower levels, liver and placenta.

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Lung cancer DISCM4YA Definitive Biomarker [1]
Lung carcinoma DISTR26C Definitive Biomarker [1]
Advanced cancer DISAT1Z9 Strong Altered Expression [2]
Alzheimer disease DISF8S70 Strong Biomarker [3]
Arteriosclerosis DISK5QGC Strong Altered Expression [4]
Arthritis DIST1YEL Strong Biomarker [5]
Atherosclerosis DISMN9J3 Strong Altered Expression [4]
B-cell neoplasm DISVY326 Strong Posttranslational Modification [6]
Breast cancer DIS7DPX1 Strong Altered Expression [7]
Breast carcinoma DIS2UE88 Strong Altered Expression [7]
Chronic obstructive pulmonary disease DISQCIRF Strong Altered Expression [8]
Colon cancer DISVC52G Strong Biomarker [9]
Colon carcinoma DISJYKUO Strong Biomarker [9]
Congestive heart failure DIS32MEA Strong Altered Expression [10]
Diabetic kidney disease DISJMWEY Strong Biomarker [11]
Endometriosis DISX1AG8 Strong Altered Expression [12]
Glioma DIS5RPEH Strong Altered Expression [13]
Head-neck squamous cell carcinoma DISF7P24 Strong Altered Expression [14]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [15]
Hyperglycemia DIS0BZB5 Strong Biomarker [16]
Melanoma DIS1RRCY Strong Biomarker [17]
Myelodysplastic syndrome DISYHNUI Strong Biomarker [18]
Myocardial infarction DIS655KI Strong Altered Expression [19]
Neoplasm DISZKGEW Strong Posttranslational Modification [20]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [21]
Obesity DIS47Y1K Strong Altered Expression [22]
Osteoarthritis DIS05URM Strong Biomarker [23]
Parkinson disease DISQVHKL Strong Biomarker [24]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [25]
Pneumonia DIS8EF3M Strong Biomarker [26]
Pneumonitis DIS88E0K Strong Biomarker [26]
Prostate cancer DISF190Y Strong Altered Expression [27]
Prostate carcinoma DISMJPLE Strong Altered Expression [27]
Retinoblastoma DISVPNPB Strong Altered Expression [28]
Rheumatoid arthritis DISTSB4J Strong Biomarker [29]
Urinary bladder cancer DISDV4T7 Strong Altered Expression [30]
Urinary bladder neoplasm DIS7HACE Strong Altered Expression [30]
Cardiac failure DISDC067 moderate Biomarker [31]
Colorectal carcinoma DIS5PYL0 moderate Biomarker [32]
leukaemia DISS7D1V moderate Biomarker [33]
Leukemia DISNAKFL moderate Biomarker [33]
Lung adenocarcinoma DISD51WR moderate Altered Expression [1]
Nervous system inflammation DISB3X5A moderate Altered Expression [34]
Neuralgia DISWO58J moderate Altered Expression [35]
Non-insulin dependent diabetes DISK1O5Z moderate Biomarker [36]
Pancreatic cancer DISJC981 moderate Biomarker [37]
Tuberculosis DIS2YIMD moderate Biomarker [38]
Neuroblastoma DISVZBI4 Limited Altered Expression [39]
Type-1/2 diabetes DISIUHAP Limited Altered Expression [40]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1) affects the response to substance of Acetaminophen. [53]
------------------------------------------------------------------------------------
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1). [41]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate affects the expression of Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1). [42]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1). [43]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1). [44]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1). [45]
Sodium phenylbutyrate DMXLBCQ Approved Sodium phenylbutyrate increases the expression of Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1). [46]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1). [47]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1). [48]
Celastrol DMWQIJX Preclinical Celastrol increases the expression of Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1). [49]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1). [50]
Coumestrol DM40TBU Investigative Coumestrol increases the expression of Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1). [51]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1). [52]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)

References

1 Synergistic Effect of Novel EGFR Inhibitor AZD8931 and p38 siRNA in Lung Adenocarcinoma Cancer Cells.Anticancer Agents Med Chem. 2019;19(5):638-644. doi: 10.2174/1871520619666190301125203.
2 IKK Promotes the Progression and Metastasis of Non-Small Cell Lung Cancer Independently of its Subcellular Localization.Comput Struct Biotechnol J. 2019 Feb 7;17:251-262. doi: 10.1016/j.csbj.2019.02.003. eCollection 2019.
3 Tanshinone IIA ameliorates cognitive deficits by inhibiting endoplasmic reticulum stress-induced apoptosis in APP/PS1 transgenic mice.Neurochem Int. 2020 Feb;133:104610. doi: 10.1016/j.neuint.2019.104610. Epub 2019 Nov 26.
4 Neutrophil extracellular traps induced by IL-8 aggravate atherosclerosis via activation NF-B signaling in macrophages.Cell Cycle. 2019 Nov;18(21):2928-2938. doi: 10.1080/15384101.2019.1662678. Epub 2019 Sep 8.
5 Inhibition of spinal p38 MAPK prevents articular neutrophil infiltration in experimental arthritis via sympathetic activation.Fundam Clin Pharmacol. 2018 Apr;32(2):155-162. doi: 10.1111/fcp.12338. Epub 2017 Dec 22.
6 TNFAIP8 promotes cisplatin resistance in cervical carcinoma cells by inhibiting cellular apoptosis.Oncol Lett. 2019 May;17(5):4667-4674. doi: 10.3892/ol.2019.10076. Epub 2019 Feb 26.
7 Cancer-associated fibroblast (CAF)-derived IL32 promotes breast cancer cell invasion and metastasis via integrin 3-p38 MAPK signalling.Cancer Lett. 2019 Feb 1;442:320-332. doi: 10.1016/j.canlet.2018.10.015. Epub 2018 Oct 27.
8 Protective Effect of Hydroxysafflor Yellow A on Inflammatory Injury in Chronic Obstructive Pulmonary Disease Rats.Chin J Integr Med. 2019 Oct;25(10):750-756. doi: 10.1007/s11655-018-2577-2. Epub 2018 Dec 27.
9 In Vitro and in Vivo antitumor activity and the mechanism of siphonodictyal B in human colon cancer cells.Cancer Med. 2019 Sep;8(12):5662-5672. doi: 10.1002/cam4.2409. Epub 2019 Jul 31.
10 Effects of steroidal saponins extract from Ophiopogon japonicus root ameliorates doxorubicin-induced chronic heart failure by inhibiting oxidative stress and inflammatory response.Pharm Biol. 2019 Dec;57(1):176-183. doi: 10.1080/13880209.2019.1577467.
11 Chemerin/ChemR23 axis promotes inflammation of glomerular endothelial cells in diabetic nephropathy.J Cell Mol Med. 2019 May;23(5):3417-3428. doi: 10.1111/jcmm.14237. Epub 2019 Feb 19.
12 Lipoxin A(4) Suppresses IL-1-Induced Cyclooxygenase-2 Expression Through Inhibition of p38 MAPK Activation in Endometriosis.Reprod Sci. 2019 Dec;26(12):1640-1649. doi: 10.1177/1933719119828115. Epub 2019 Feb 17.
13 Correction to: inhibition of p38 MAPK activity leads to cell type-specific effects on the molecular circadian clock and time-dependent reduction of glioma cell invasiveness.BMC Cancer. 2019 Jan 23;19(1):101. doi: 10.1186/s12885-018-5238-0.
14 PRRX1 Regulates Cellular Phenotype Plasticity and Dormancy of Head and Neck Squamous Cell Carcinoma Through miR-642b-3p.Neoplasia. 2019 Feb;21(2):216-229. doi: 10.1016/j.neo.2018.12.001. Epub 2019 Jan 7.
15 Targeting monocyte-intrinsic enhancer reprogramming improves immunotherapy efficacy in hepatocellular carcinoma.Gut. 2020 Feb;69(2):365-379. doi: 10.1136/gutjnl-2018-317257. Epub 2019 May 10.
16 Regulation of MAP kinase-mediated endothelial dysfunction in hyperglycemia via arginase I and eNOS dysregulation.Biochim Biophys Acta Mol Cell Res. 2019 Sep;1866(9):1398-1411. doi: 10.1016/j.bbamcr.2019.05.004. Epub 2019 May 28.
17 SHARPIN Promotes Melanoma Progression viaRap1 Signaling Pathway.J Invest Dermatol. 2020 Feb;140(2):395-403.e6. doi: 10.1016/j.jid.2019.07.696. Epub 2019 Aug 8.
18 Iron overload may promote alteration of NK cells and hematopoietic stem/progenitor cells by JNK and P38 pathway in myelodysplastic syndromes.Int J Hematol. 2017 Aug;106(2):248-257. doi: 10.1007/s12185-017-2237-x. Epub 2017 Apr 12.
19 Effect of ulinastatin on myocardial ischemia-reperfusion injury through JNK and P38 MAPK signaling pathways.Eur Rev Med Pharmacol Sci. 2019 Oct;23(19):8658-8664. doi: 10.26355/eurrev_201910_19183.
20 Hyperoside exerts potent anticancer activity in skin cancer.Front Biosci (Landmark Ed). 2020 Jan 1;25(3):463-479. doi: 10.2741/4814.
21 LukS-PV induces cell cycle arrest and apoptosis through p38/ERK MAPK signaling pathway in NSCLC cells.Biochem Biophys Res Commun. 2020 Jan 22;521(4):846-852. doi: 10.1016/j.bbrc.2019.10.181. Epub 2019 Nov 7.
22 GDF5 Promotes White Adipose Tissue Thermogenesis via p38 MAPK Signaling Pathway.DNA Cell Biol. 2019 Nov;38(11):1303-1312. doi: 10.1089/dna.2019.4724. Epub 2019 Sep 25.
23 Tougu Xiaotong capsules may inhibit p38 MAPK pathway-mediated inflammation: In vivo and in vitro verification.J Ethnopharmacol. 2020 Mar 1;249:112390. doi: 10.1016/j.jep.2019.112390. Epub 2019 Nov 21.
24 MicroRNA-124 regulates the expression of p62/p38 and promotes autophagy in the inflammatory pathogenesis of Parkinson's disease.FASEB J. 2019 Jul;33(7):8648-8665. doi: 10.1096/fj.201900363R. Epub 2019 Apr 17.
25 Rafoxanide, an organohalogen drug, triggers apoptosis and cell cycle arrest in multiple myeloma by enhancing DNA damage responses and suppressing the p38 MAPK pathway.Cancer Lett. 2019 Mar 1;444:45-59. doi: 10.1016/j.canlet.2018.12.014. Epub 2018 Dec 21.
26 Epicatechin alleviates inflammation in lipopolysaccharide-induced acute lung injury in mice by inhibiting the p38 MAPK signaling pathway.Int Immunopharmacol. 2019 Jan;66:146-153. doi: 10.1016/j.intimp.2018.11.016. Epub 2018 Nov 16.
27 Knockdown of COPS3 inhibits the progress of prostate cancer through reducing phosphorylated p38 MAPK expression and impairs the epithelial-mesenchymal transition process.Prostate. 2019 Dec;79(16):1823-1831. doi: 10.1002/pros.23907. Epub 2019 Sep 11.
28 Piperlongumine decreases cell proliferation and the expression of cell cycle-associated proteins by inhibiting Akt pathway in human lung cancer cells. Food Chem Toxicol. 2018 Jan;111:9-18. doi: 10.1016/j.fct.2017.10.058. Epub 2017 Nov 7.
29 Protective Effects of Prunasin A against the Differentiation of Osteoclasts and Destruction of Cartilage via the Receptor Activator of Nuclear Factor-Kappa- Ligand/Mitogen-Activated Protein Kinase/Osteoprotegerin Pathway in a Rat Model of Arthritis.Pharmacology. 2019;104(5-6):216-225. doi: 10.1159/000502537. Epub 2019 Sep 12.
30 An FGFR3/MYC positive feedback loop provides new opportunities for targeted therapies in bladder cancers.EMBO Mol Med. 2018 Apr;10(4):e8163. doi: 10.15252/emmm.201708163.
31 p38 MAPK proximity assay reveals a regulatory mechanism of alternative splicing in cardiomyocytes.Biochim Biophys Acta Mol Cell Res. 2019 Dec;1866(12):118557. doi: 10.1016/j.bbamcr.2019.118557. Epub 2019 Sep 7.
32 p38-regulated FOXC1 stability is required for colorectal cancer metastasis.J Pathol. 2020 Feb;250(2):217-230. doi: 10.1002/path.5362. Epub 2019 Nov 28.
33 Quinacrine induces apoptosis in human leukemia K562 cells via p38 MAPK-elicited BCL2 down-regulation and suppression of ERK/c-Jun-mediated BCL2L1 expression.Toxicol Appl Pharmacol. 2015 Apr 1;284(1):33-41. doi: 10.1016/j.taap.2015.02.005. Epub 2015 Feb 12.
34 Graphene quantum dots inhibit T cell-mediated neuroinflammation in rats.Neuropharmacology. 2019 Mar 1;146:95-108. doi: 10.1016/j.neuropharm.2018.11.030. Epub 2018 Nov 22.
35 Astrocyte activation in the periaqueductal gray promotes descending facilitation to cancer-induced bone pain through the JNK MAPK signaling pathway.Mol Pain. 2019 Jan-Dec;15:1744806919831909. doi: 10.1177/1744806919831909.
36 Large triglyceride-rich lipoproteins from fasting patients with type 2 diabetes activate platelets.Diabetes Metab. 2020 Feb;46(1):54-60. doi: 10.1016/j.diabet.2019.03.002. Epub 2019 Apr 11.
37 Aberrant expression of STYK1 and E-cadherin confer a poor prognosis for pancreatic cancer patients.Oncotarget. 2017 Nov 30;8(67):111333-111345. doi: 10.18632/oncotarget.22794. eCollection 2017 Dec 19.
38 A novel MtHSP70-FPR1 fusion protein enhances cytotoxic T lymphocyte responses to cervical cancer cells by activating human monocyte-derived dendritic cells via the p38 MAPK signaling pathway.Biochem Biophys Res Commun. 2018 Sep 10;503(3):2108-2116. doi: 10.1016/j.bbrc.2018.07.167. Epub 2018 Aug 8.
39 Macrophage-Derived IL1 and TNF Regulate Arginine Metabolism in Neuroblastoma.Cancer Res. 2019 Feb 1;79(3):611-624. doi: 10.1158/0008-5472.CAN-18-2139. Epub 2018 Dec 13.
40 Deep sea minerals ameliorate diabetic-induced inflammation via inhibition of TNF signaling pathways.Environ Toxicol. 2020 Apr;35(4):468-477. doi: 10.1002/tox.22882. Epub 2019 Dec 3.
41 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
42 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
43 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
44 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
45 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
46 Gene expression profile analysis of 4-phenylbutyrate treatment of IB3-1 bronchial epithelial cell line demonstrates a major influence on heat-shock proteins. Physiol Genomics. 2004 Jan 15;16(2):204-11.
47 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
48 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
49 Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
50 Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
51 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
52 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
53 Interindividual variation in gene expression responses and metabolite formation in acetaminophen-exposed primary human hepatocytes. Arch Toxicol. 2016 May;90(5):1103-15. doi: 10.1007/s00204-015-1545-2. Epub 2015 Jun 24.