Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTE0W7LN)

• DOT Name: D site-binding protein (DBP)
• Synonyms: Albumin D box-binding protein; Albumin D-element-binding protein; Tax-responsive enhancer element-binding protein 302; TaxREB302
• Gene Name: DBP
• Related Disease:
  Malaria
  Multiple sclerosis
  Acute coronary syndrome
  Advanced cancer
  Analgesia
  Androgen insensitivity syndrome
  Arteriosclerosis
  Autoimmune disease
  Cardiac failure
  Congestive heart failure
  Coronary atherosclerosis
  Coronary heart disease
  Cryohydrocytosis
  Diabetic kidney disease
  Fatty liver disease
  Graves disease
  Hepatocellular carcinoma
  Hyperglycemia
  Hyperinsulinemia
  Hypertension, pregnancy-induced
  Inflammatory bowel disease
  Liver cirrhosis
  Myocardial infarction
  Neoplasm
  Non-alcoholic fatty liver disease
  Obstructive sleep apnea
  Osteoarthritis
  Osteoporosis
  Polycystic ovarian syndrome
  Polyp
  Rheumatoid arthritis
  Triple negative breast cancer
  Tuberculosis
  Type-1 diabetes
  Chronic obstructive pulmonary disease
  Chronic renal failure
  End-stage renal disease
  Kidney cancer
  Renal carcinoma
  Glioma
  Ankylosing spondylitis
  Atherosclerosis
  Chronic kidney disease
  Essential hypertension
  Prediabetes syndrome
  Subarachnoid hemorrhage
  Temporal lobe epilepsy
  Uveitis
• UniProt ID: DBP_HUMAN
• Pfam ID: PF07716
• Sequence:
  MARPVSDRTPAPLLLGGPAGTPPGGGALLGLRSLLQGTSKPKEPASCLLKEKERKAALPA
  ATTPGPGLETAGPADAPAGAVVGGGSPRGRPGPVPAPGLLAPLLWERTLPFGDVEYVDLD
  AFLLEHGLPPSPPPPGGPSPEPSPARTPAPSPGPGSCGSASPRSSPGHAPARAALGTASG
  HRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPI
  MKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQE
  VVAVRQELSHYRAVLSRYQAQHGAL
• Function: This transcriptional activator recognizes and binds to the sequence 5'-RTTAYGTAAY-3' found in the promoter of genes such as albumin, CYP2A4 and CYP2A5. It is not essential for circadian rhythm generation, but modulates important clock output genes. May be a direct target for regulation by the circadian pacemaker component clock. May affect circadian period and sleep regulation.
• Tissue Specificity: Ubiquitously expressed. Expressed in the suprachiasmatic nuclei (SCN) and in most peripheral tissues, with a strong circadian rhythmicity.
• KEGG Pathway: Circadian rhythm (hsa04710)
• Reactome Pathway: BMAL1 (R-HSA-1368108)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Malaria	DISQ9Y50	Definitive	Biomarker	[1]
Multiple sclerosis	DISB2WZI	Definitive	Genetic Variation	[2]
Acute coronary syndrome	DIS7DYEW	Strong	Biomarker	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Analgesia	DISK3TVI	Strong	Biomarker	[5]
Androgen insensitivity syndrome	DISUZBBO	Strong	Biomarker	[6]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[7]
Autoimmune disease	DISORMTM	Strong	Genetic Variation	[8]
Cardiac failure	DISDC067	Strong	Altered Expression	[9]
Congestive heart failure	DIS32MEA	Strong	Altered Expression	[9]
Coronary atherosclerosis	DISKNDYU	Strong	Biomarker	[10]
Coronary heart disease	DIS5OIP1	Strong	Biomarker	[11]
Cryohydrocytosis	DISMQHL3	Strong	Genetic Variation	[12]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[13]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[14]
Graves disease	DISU4KOQ	Strong	Genetic Variation	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[16]
Hyperglycemia	DIS0BZB5	Strong	Biomarker	[17]
Hyperinsulinemia	DISIDWT6	Strong	Biomarker	[18]
Hypertension, pregnancy-induced	DISHNU25	Strong	Altered Expression	[19]
Inflammatory bowel disease	DISGN23E	Strong	Genetic Variation	[20]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[21]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[22]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[4]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[23]
Obstructive sleep apnea	DIS0SVD1	Strong	Genetic Variation	[24]
Osteoarthritis	DIS05URM	Strong	Biomarker	[25]
Osteoporosis	DISF2JE0	Strong	Genetic Variation	[26]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[27]
Polyp	DISRSLYF	Strong	Biomarker	[28]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[29]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[30]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[31]
Type-1 diabetes	DIS7HLUB	Strong	Biomarker	[32]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Genetic Variation	[33]
Chronic renal failure	DISGG7K6	moderate	Biomarker	[34]
End-stage renal disease	DISXA7GG	moderate	Biomarker	[34]
Kidney cancer	DISBIPKM	moderate	Genetic Variation	[35]
Renal carcinoma	DISER9XT	moderate	Genetic Variation	[35]
Glioma	DIS5RPEH	Disputed	Altered Expression	[36]
Ankylosing spondylitis	DISRC6IR	Limited	Genetic Variation	[37]
Atherosclerosis	DISMN9J3	Limited	Altered Expression	[38]
Chronic kidney disease	DISW82R7	Limited	Genetic Variation	[39]
Essential hypertension	DIS7WI98	Limited	Biomarker	[40]
Prediabetes syndrome	DISH2I53	Limited	Genetic Variation	[41]
Subarachnoid hemorrhage	DISI7I8Y	Limited	Biomarker	[42]
Temporal lobe epilepsy	DISNOPXX	Limited	Biomarker	[43]
Uveitis	DISV0RYS	Limited	Genetic Variation	[37]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of D site-binding protein (DBP).	[44]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of D site-binding protein (DBP).	[45]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of D site-binding protein (DBP).	[46]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of D site-binding protein (DBP).	[47]
Prednisolone	DMQ8FR2	Approved	Prednisolone decreases the expression of D site-binding protein (DBP).	[48]
GSK2110183	DMZHB37	Phase 2	GSK2110183 increases the expression of D site-binding protein (DBP).	[49]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of D site-binding protein (DBP).	[50]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of D site-binding protein (DBP).	[51]

References

• [1] Sequence diversity and positive selection at the Duffy-binding protein genes of Plasmodium knowlesi and P. cynomolgi: Analysis of the complete coding sequences of Thai isolates.Infect Genet Evol. 2016 Oct;44:367-375. doi: 10.1016/j.meegid.2016.07.040. Epub 2016 Jul 30.
• [2] Vitamin D-binding protein gene polymorphisms are not associated with MS risk in an Italian cohort.J Neuroimmunol. 2017 Apr 15;305:92-95. doi: 10.1016/j.jneuroim.2017.02.009. Epub 2017 Feb 8.
• [3] Hypertensive emergencies and urgencies: a single-centre experience in Northern Italy 2008-2015.J Hypertens. 2020 Jan;38(1):52-58. doi: 10.1097/HJH.0000000000002213.
• [4] Symmetric dimeric bisbenzimidazoles DBP(n) reduce methylation of RARB and PTEN while significantly increase methylation of rRNA genes in MCF-7 cancer cells.PLoS One. 2018 Jan 12;13(1):e0189826. doi: 10.1371/journal.pone.0189826. eCollection 2018.
• [5] Buprenorphine-Sustained Release Alters Hemodynamic Parameters in a Rat Burn Model.J Surg Res. 2018 Dec;232:154-159. doi: 10.1016/j.jss.2018.03.016. Epub 2018 Jul 5.
• [6] Differential proteome analysis in adolescent idiopathic scoliosis patients with thoracolumbar/lumbar curvatures.BMC Musculoskelet Disord. 2019 May 24;20(1):247. doi: 10.1186/s12891-019-2640-y.
• [7] Prehypertension increases the risk of atherosclerosis in drug-nave Japanese patients with type 2 diabetes mellitus.PLoS One. 2018 Jul 20;13(7):e0201055. doi: 10.1371/journal.pone.0201055. eCollection 2018.
• [8] Single nucleotide polymorphisms in the vitamin D pathway associating with circulating concentrations of vitamin D metabolites and non-skeletal health outcomes: Review of genetic association studies.J Steroid Biochem Mol Biol. 2016 Nov;164:18-29. doi: 10.1016/j.jsbmb.2015.12.007. Epub 2015 Dec 11.
• [9] Serum irisin level in myocardial infarction patients with or without heart failure.Can J Physiol Pharmacol. 2019 Oct;97(10):932-938. doi: 10.1139/cjpp-2018-0736. Epub 2019 Apr 8.
• [10] Mortality implications of lower DBP with lower achieved systolic pressures in coronary artery disease: long-term mortality results from the INternational VErapamil-trandolapril STudy US cohort.J Hypertens. 2018 Feb;36(2):419-427. doi: 10.1097/HJH.0000000000001559.
• [11] Mechanisms underlying the J-curve for diastolic blood pressure: Subclinical myocardial injury and immune activation.Int J Cardiol. 2019 Feb 1;276:255-260. doi: 10.1016/j.ijcard.2018.09.028. Epub 2018 Sep 8.
• [12] GC Gene Polymorphism and Unbound Serum Retinol-Binding Protein 4 Are Related to the Risk of Insulin Resistance in Patients With Chronic Hepatitis C: A Prospective Cross-Sectional Study.Medicine (Baltimore). 2016 Mar;95(10):e3019. doi: 10.1097/MD.0000000000003019.
• [13] Matrix Metalloproteinase-9 -1562C/T Gene Polymorphism Is Associated with Diabetic Nephropathy.Biomed Res Int. 2016;2016:1627143. doi: 10.1155/2016/1627143. Epub 2016 Aug 18.
• [14] Atherogenic index of plasma is a novel and strong predictor associated with fatty liver: a cross-sectional study in the Chinese Han population.Lipids Health Dis. 2019 Sep 12;18(1):170. doi: 10.1186/s12944-019-1112-6.
• [15] Vitamin D-binding protein (DBP) gene polymorphism is associated with Graves' disease and the vitamin D status in a Polish population study.Exp Clin Endocrinol Diabetes. 2006 Jun;114(6):329-35. doi: 10.1055/s-2006-924256.
• [16] Association of single nucleotide polymorphisms in VDR and DBP genes with HBV-related hepatocellular carcinoma risk in a Chinese population.PLoS One. 2014 Dec 26;9(12):e116026. doi: 10.1371/journal.pone.0116026. eCollection 2014.
• [17] Biochemical Data and Metabolic Profiles of Male Exclusive Narghile Smokers (ENSs) Compared With Apparently Healthy Nonsmokers (AHNSs).Am J Mens Health. 2019 Jan-Feb;13(1):1557988319825754. doi: 10.1177/1557988319825754.
• [18] Adiponectin--insulin and resistin plasma levels in young healthy offspring of patients with essential hypertension.Blood Press. 2008;17(1):50-4. doi: 10.1080/08037050701876307.
• [19] Feature of trajectory of blood pressure among pregnant women with gestational hypertension.J Hypertens. 2020 Jan;38(1):127-132. doi: 10.1097/HJH.0000000000002197.
• [20] Association of a common vitamin D-binding protein polymorphism with inflammatory bowel disease.Pharmacogenet Genomics. 2011 Sep;21(9):559-64. doi: 10.1097/FPC.0b013e328348f70c.
• [21] Validation of non-invasive haemodynamic methods in patients with liver disease: the Finometer and the Task Force Monitor.Clin Physiol Funct Imaging. 2018 May;38(3):384-389. doi: 10.1111/cpf.12425. Epub 2017 Apr 12.
• [22] Prehypertension and risk of cardiovascular diseases: a meta-analysis of 47 cohort studies.J Hypertens. 2019 Dec;37(12):2325-2332. doi: 10.1097/HJH.0000000000002191.
• [23] The impact of the sleep duration on NAFLD score in Korean middle-aged adults: a community-based cohort study.Sleep Med. 2019 May;57:144-150. doi: 10.1016/j.sleep.2019.02.012. Epub 2019 Mar 2.
• [24] Association of JAG1 gene polymorphism with systemic blood pressure in patients with obstructive sleep apnea: a prospective cohort study.Croat Med J. 2019 Oct 31;60(5):421-430. doi: 10.3325/cmj.2019.60.421.
• [25] Clock gene expression in different synovial cells of patients with rheumatoid arthritis and osteoarthritis.Acta Histochem. 2014 Sep;116(7):1199-207. doi: 10.1016/j.acthis.2014.07.001. Epub 2014 Aug 7.
• [26] Association of Thr420Lys polymorphism in DBP gene with fat-soluble vitamins and low radial bone mineral density in postmenopausal Thai women.Biomark Med. 2012 Feb;6(1):103-8. doi: 10.2217/bmm.11.88.
• [27] Association of Luteinizing hormone and LH receptor gene polymorphism with susceptibility of Polycystic ovary syndrome.Syst Biol Reprod Med. 2019 Oct;65(5):400-408. doi: 10.1080/19396368.2019.1595217. Epub 2019 Apr 8.
• [28] Environmental control of asexual reproduction and somatic growth of Aurelia spp. (Cnidaria, Scyphozoa) polyps from the Adriatic Sea.PLoS One. 2017 Jun 14;12(6):e0178482. doi: 10.1371/journal.pone.0178482. eCollection 2017.
• [29] Initiation of Disease-Modifying Therapies in Rheumatoid Arthritis Is Associated With Changes in Blood Pressure.J Clin Rheumatol. 2018 Jun;24(4):203-209. doi: 10.1097/RHU.0000000000000736.
• [30] Blood pressure and risk of breast cancer, overall and by subtypes: a prospective cohort study.J Hypertens. 2017 Jul;35(7):1371-1380. doi: 10.1097/HJH.0000000000001372.
• [31] Sputum Proteomics Reveals a Shift in Vitamin D-binding Protein and Antimicrobial Protein Axis in Tuberculosis Patients.Sci Rep. 2019 Jan 31;9(1):1036. doi: 10.1038/s41598-018-37662-9.
• [32] The Role of Vitamin D Binding Protein, Total and Free 25-Hydroxyvitamin D in Diabetes.Front Endocrinol (Lausanne). 2019 Feb 19;10:79. doi: 10.3389/fendo.2019.00079. eCollection 2019.
• [33] Correlation of vitamin D binding protein gene polymorphism and protein levels in chronic obstructive pulmonary disease compared with non-chronic obstructive pulmonary disease subjects.Per Med. 2018 Sep;15(5):371-379. doi: 10.2217/pme-2018-0005. Epub 2018 Sep 27.
• [34] Changes in whole blood viscosity during hemodialysis and mortality in patients with end-stage renal disease.Clin Hemorheol Microcirc. 2017;65(3):285-297. doi: 10.3233/CH-16183.
• [35] Blood pressure and kidney cancer risk: meta-analysis of prospective studies.J Hypertens. 2017 Jul;35(7):1333-1344. doi: 10.1097/HJH.0000000000001286.
• [36] Identification of novel oligodendroglioma-associated candidate tumor suppressor genes in 1p36 and 19q13 using microarray-based expression profiling.Int J Cancer. 2006 Aug 15;119(4):792-800. doi: 10.1002/ijc.21901.
• [37] Associations of vitamin d binding protein gene polymorphisms with the development of peripheral arthritis and uveitis in ankylosing spondylitis.J Rheumatol. 2011 Oct;38(10):2224-9. doi: 10.3899/jrheum.101244. Epub 2011 Aug 15.
• [38] LIPID ACCUMULATION PRODUCT, VISCERAL ADIPOSITY INDEX, AND CHINESE VISCERAL ADIPOSITY INDEX AS MARKERS OF CARDIOMETABOLIC RISK IN ADULT GROWTH HORMONE DEFICIENCY PATIENTS: A CROSS-SECTIONAL STUDY.Endocr Pract. 2018 Jan;24(1):33-39. doi: 10.4158/EP-2017-0007. Epub 2017 Nov 16.
• [39] Validity of self blood pressure measurement in the control of the hypertensive patient: factors involved.BMC Cardiovasc Disord. 2019 Jul 17;19(1):171. doi: 10.1186/s12872-019-1145-9.
• [40] Associations of CYP4A11 gene-gene and gene-smoking interactions with essential hypertension in the male eastern Chinese Han population.Clin Exp Hypertens. 2017;39(5):448-453. doi: 10.1080/10641963.2016.1267201. Epub 2017 May 23.
• [41] Determination of Free 25(OH)D Concentrations and Their Relationships to Total 25(OH)D in Multiple Clinical Populations.J Clin Endocrinol Metab. 2018 Sep 1;103(9):3278-3288. doi: 10.1210/jc.2018-00295.
• [42] Heart rate variability after endovascular coiling is associated with short-term outcomes in patients with subarachnoid hemorrhage.Neurol Res. 2018 Oct;40(10):856-861. doi: 10.1080/01616412.2018.1493973. Epub 2018 Jul 26.
• [43] Proteomic analysis of cerebrospinal fluid from patients with idiopathic temporal lobe epilepsy.Brain Res. 2009 Feb 19;1255:180-9. doi: 10.1016/j.brainres.2008.12.008. Epub 2008 Dec 11.
• [44] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [45] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [46] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [47] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [48] Chronic treatment with prednisolone represses the circadian oscillation of clock gene expression in mouse peripheral tissues. Mol Endocrinol. 2006 Mar;20(3):573-83. doi: 10.1210/me.2005-0165. Epub 2005 Nov 3.
• [49] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [50] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [51] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.