Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTE1NB6U)

DOT Name Regulator of microtubule dynamics protein 1 (RMDN1)
Synonyms RMD-1; hRMD-1; Protein FAM82B
Gene Name RMDN1
Related Disease
Rheumatoid arthritis ( )
Acute myelogenous leukaemia ( )
Adult glioblastoma ( )
Advanced cancer ( )
Alzheimer disease ( )
Autism spectrum disorder ( )
B-cell lymphoma ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Cardiac failure ( )
Childhood acute lymphoblastic leukemia ( )
Chronic kidney disease ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal neoplasm ( )
Congestive heart failure ( )
Diabetic kidney disease ( )
Endometriosis ( )
Epilepsy ( )
Frontotemporal dementia ( )
Glioblastoma multiforme ( )
Glioma ( )
Hepatocellular carcinoma ( )
Lung adenocarcinoma ( )
Mental disorder ( )
Multiple sclerosis ( )
Myocardial infarction ( )
Neoplasm ( )
Nervous system inflammation ( )
Non-small-cell lung cancer ( )
Prostate cancer ( )
Prostate carcinoma ( )
Pulmonary fibrosis ( )
Systemic lupus erythematosus ( )
Tauopathy ( )
Epithelial ovarian cancer ( )
Melanoma ( )
Parkinson disease ( )
Squamous cell carcinoma ( )
Acute lymphocytic leukaemia ( )
B-cell neoplasm ( )
Hepatitis C virus infection ( )
High blood pressure ( )
Nasopharyngeal carcinoma ( )
Osteoarthritis ( )
Pancreatic cancer ( )
Thyroid gland papillary carcinoma ( )
Type-1 diabetes ( )
Type-1/2 diabetes ( )
UniProt ID
RMD1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF21033
Sequence
MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGTFKRGLLLSAL
SYLGFETYQVISQAAVVHATAKVEEILEQADYLYESGETEKLYQLLTQYKESEDAELLWR
LARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESSFASHKWYAICLSDVGDYEGI
KAKIANAYIIKEHFEKAIELNPKDATSIHLMGIWCYTFAEMPWYQRRIAKMLFATPPSST
YEKALGYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAAFWLMKAKDYPAHTEEDKQIQ
TEAAQLLTSFSEKN

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Rheumatoid arthritis DISTSB4J Definitive Biomarker [1]
Acute myelogenous leukaemia DISCSPTN Strong Altered Expression [2]
Adult glioblastoma DISVP4LU Strong Altered Expression [3]
Advanced cancer DISAT1Z9 Strong Altered Expression [4]
Alzheimer disease DISF8S70 Strong Biomarker [5]
Autism spectrum disorder DISXK8NV Strong Biomarker [6]
B-cell lymphoma DISIH1YQ Strong Altered Expression [7]
Breast cancer DIS7DPX1 Strong Altered Expression [8]
Breast carcinoma DIS2UE88 Strong Altered Expression [8]
Breast neoplasm DISNGJLM Strong Altered Expression [9]
Cardiac failure DISDC067 Strong Biomarker [10]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Altered Expression [2]
Chronic kidney disease DISW82R7 Strong Altered Expression [11]
Colon cancer DISVC52G Strong Altered Expression [12]
Colon carcinoma DISJYKUO Strong Altered Expression [12]
Colorectal neoplasm DISR1UCN Strong Altered Expression [13]
Congestive heart failure DIS32MEA Strong Biomarker [10]
Diabetic kidney disease DISJMWEY Strong Genetic Variation [14]
Endometriosis DISX1AG8 Strong Biomarker [15]
Epilepsy DISBB28L Strong Biomarker [16]
Frontotemporal dementia DISKYHXL Strong Biomarker [17]
Glioblastoma multiforme DISK8246 Strong Altered Expression [3]
Glioma DIS5RPEH Strong Altered Expression [18]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [19]
Lung adenocarcinoma DISD51WR Strong Genetic Variation [20]
Mental disorder DIS3J5R8 Strong Biomarker [21]
Multiple sclerosis DISB2WZI Strong Biomarker [22]
Myocardial infarction DIS655KI Strong Biomarker [23]
Neoplasm DISZKGEW Strong Biomarker [24]
Nervous system inflammation DISB3X5A Strong Biomarker [25]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [26]
Prostate cancer DISF190Y Strong Biomarker [27]
Prostate carcinoma DISMJPLE Strong Biomarker [27]
Pulmonary fibrosis DISQKVLA Strong Biomarker [28]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [25]
Tauopathy DISY2IPA Strong Biomarker [29]
Epithelial ovarian cancer DIS56MH2 moderate Biomarker [30]
Melanoma DIS1RRCY moderate Biomarker [31]
Parkinson disease DISQVHKL moderate Biomarker [25]
Squamous cell carcinoma DISQVIFL moderate Altered Expression [32]
Acute lymphocytic leukaemia DISPX75S Disputed Altered Expression [2]
B-cell neoplasm DISVY326 Limited Altered Expression [33]
Hepatitis C virus infection DISQ0M8R Limited Biomarker [34]
High blood pressure DISY2OHH Limited Biomarker [35]
Nasopharyngeal carcinoma DISAOTQ0 Limited Biomarker [36]
Osteoarthritis DIS05URM Limited Biomarker [37]
Pancreatic cancer DISJC981 Limited Altered Expression [38]
Thyroid gland papillary carcinoma DIS48YMM Limited Biomarker [39]
Type-1 diabetes DIS7HLUB Limited Biomarker [40]
Type-1/2 diabetes DISIUHAP Limited Altered Expression [41]
------------------------------------------------------------------------------------
⏷ Show the Full List of 50 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Regulator of microtubule dynamics protein 1 (RMDN1). [42]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Regulator of microtubule dynamics protein 1 (RMDN1). [43]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Regulator of microtubule dynamics protein 1 (RMDN1). [44]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Regulator of microtubule dynamics protein 1 (RMDN1). [45]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Regulator of microtubule dynamics protein 1 (RMDN1). [46]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Regulator of microtubule dynamics protein 1 (RMDN1). [47]
Isotretinoin DM4QTBN Approved Isotretinoin decreases the expression of Regulator of microtubule dynamics protein 1 (RMDN1). [48]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Regulator of microtubule dynamics protein 1 (RMDN1). [49]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Regulator of microtubule dynamics protein 1 (RMDN1). [50]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate decreases the expression of Regulator of microtubule dynamics protein 1 (RMDN1). [51]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
[3H]methyltrienolone DMTSGOW Investigative [3H]methyltrienolone affects the localization of Regulator of microtubule dynamics protein 1 (RMDN1). [52]
------------------------------------------------------------------------------------

References

1 Arsenic Trioxide in Synergy with Vitamin D Rescues the Defective VDR-PPAR- Functional Module of Autophagy in Rheumatoid Arthritis.PPAR Res. 2019 May 7;2019:6403504. doi: 10.1155/2019/6403504. eCollection 2019.
2 Beclin-1 and hypoxia-inducible factor-1 genes expression: Potential biomarkers in acute leukemia patients.Cancer Biomark. 2016 Mar 18;16(4):619-26. doi: 10.3233/CBM-160603.
3 Sinomenine Hydrochloride Inhibits the Metastasis of Human Glioblastoma Cells by Suppressing the Expression of Matrix Metalloproteinase-2/-9 and Reversing the Endogenous and Exogenous Epithelial-Mesenchymal Transition.Int J Mol Sci. 2018 Mar 14;19(3):844. doi: 10.3390/ijms19030844.
4 The prognostic value of theTau protein serum level in metastatic breast cancer patients and its correlation with brain metastases.BMC Cancer. 2019 Jan 30;19(1):110. doi: 10.1186/s12885-019-5287-z.
5 Effect of site-specific amino acid D-isomerization on -sheet transition and fibril formation profiles of Tau microtubule-binding repeat peptides.Biochem Biophys Res Commun. 2019 Jan 1;508(1):184-190. doi: 10.1016/j.bbrc.2018.11.043. Epub 2018 Nov 22.
6 Role of Microtubule-Associated Protein in Autism Spectrum Disorder.Neurosci Bull. 2018 Dec;34(6):1119-1126. doi: 10.1007/s12264-018-0246-2. Epub 2018 Jun 23.
7 Tenovin-6 inhibits proliferation and survival of diffuse large B-cell lymphoma cells by blocking autophagy.Oncotarget. 2017 Feb 28;8(9):14912-14924. doi: 10.18632/oncotarget.14741.
8 High-mobility group box 1 released by autophagic cancer-associated fibroblasts maintains the stemness of luminal breast cancer cells.J Pathol. 2017 Nov;243(3):376-389. doi: 10.1002/path.4958. Epub 2017 Sep 21.
9 Improving breast cancer sensitivity to paclitaxel by increasing aneuploidy.Proc Natl Acad Sci U S A. 2019 Nov 19;116(47):23691-23697. doi: 10.1073/pnas.1910824116. Epub 2019 Nov 4.
10 Ultrastructure and regulation of lateralized connexin43 in the failing heart.Circ Res. 2010 Apr 2;106(6):1153-63. doi: 10.1161/CIRCRESAHA.108.182147. Epub 2010 Feb 18.
11 Hyperphosphatemia induces protective autophagy in endothelial cells through the inhibition of Akt/mTOR signaling.J Vasc Surg. 2015 Jul;62(1):210-221.e2. doi: 10.1016/j.jvs.2014.02.040. Epub 2014 May 3.
12 TPX2 is a novel prognostic marker for the growth and metastasis of colon cancer.J Transl Med. 2013 Dec 17;11:313. doi: 10.1186/1479-5876-11-313.
13 Expression of the microtubule-associated protein MAP9/ASAP and its partners AURKA and PLK1 in colorectal and breast cancers.Dis Markers. 2014;2014:798170. doi: 10.1155/2014/798170. Epub 2014 Apr 30.
14 Evaluation of urinary autophagy transcripts expression in diabetic kidney disease.J Diabetes Complications. 2017 Oct;31(10):1491-1498. doi: 10.1016/j.jdiacomp.2017.06.009. Epub 2017 Jun 27.
15 Expression and significance of autophagy genes LC3, Beclin1 and MMP-2 in endometriosis.Exp Ther Med. 2018 Sep;16(3):1958-1962. doi: 10.3892/etm.2018.6362. Epub 2018 Jun 27.
16 Tau Related Pathways as a Connecting Link between Epilepsy and Alzheimer's Disease.ACS Chem Neurosci. 2019 Oct 16;10(10):4199-4212. doi: 10.1021/acschemneuro.9b00460. Epub 2019 Sep 30.
17 Tau in neurodegenerative disease.Ann Transl Med. 2018 May;6(10):175. doi: 10.21037/atm.2018.04.23.
18 AMPK-dependent autophagy upregulation serves as a survival mechanism in response to Tumor Treating Fields (TTFields).Cell Death Dis. 2018 Oct 19;9(11):1074. doi: 10.1038/s41419-018-1085-9.
19 Suppressor of hepatocellular carcinoma RASSF1A activates autophagy initiation and maturation.Cell Death Differ. 2019 Aug;26(8):1379-1395. doi: 10.1038/s41418-018-0211-7. Epub 2018 Oct 12.
20 The human Bcl-2 family member Bcl-rambo and voltage-dependent anion channels manifest a genetic interaction in Drosophila and cooperatively promote the activation of effector caspases in human cultured cells.Exp Cell Res. 2019 Aug 15;381(2):223-234. doi: 10.1016/j.yexcr.2019.05.015. Epub 2019 May 15.
21 Microtubule and microtubule associated protein anomalies in psychiatric disease.Cytoskeleton (Hoboken). 2016 Oct;73(10):596-611. doi: 10.1002/cm.21300. Epub 2016 May 20.
22 Sex-specific Tau methylation patterns and synaptic transcriptional alterations are associated with neural vulnerability during chronic neuroinflammation.J Autoimmun. 2019 Jul;101:56-69. doi: 10.1016/j.jaut.2019.04.003. Epub 2019 Apr 19.
23 Alterations of autophagic-lysosomal system in the peripheral leukocytes of patients with myocardial infarction.Clin Chim Acta. 2011 Aug 17;412(17-18):1567-71. doi: 10.1016/j.cca.2011.05.002. Epub 2011 May 7.
24 Dual-functionality of RASSF1A overexpression in A375 cells is mediated by activation of IL-6/STAT3 regulatory loop.Mol Biol Rep. 2018 Oct;45(5):1277-1287. doi: 10.1007/s11033-018-4288-3. Epub 2018 Aug 3.
25 Autophagy: a potential key contributor to the therapeutic action of mesenchymal stem cells.Autophagy. 2020 Jan;16(1):28-37. doi: 10.1080/15548627.2019.1630223. Epub 2019 Jun 18.
26 AZD9291 promotes autophagy and inhibits PI3K/Akt pathway in NSCLC cancer cells. J Cell Biochem. 2019 Jan;120(1):756-767. doi: 10.1002/jcb.27434. Epub 2018 Aug 26.
27 A novel role for MAP1 LC3 in nonautophagic cytoplasmic vacuolation death of cancer cells.Oncogene. 2009 Jul 16;28(28):2556-68. doi: 10.1038/onc.2009.118. Epub 2009 May 18.
28 Beclin 1, LC3, and p62 expression in paraquat-induced pulmonary fibrosis.Hum Exp Toxicol. 2019 Jul;38(7):794-802. doi: 10.1177/0960327119842633. Epub 2019 Apr 12.
29 Why Microtubules Should Be Considered as One of the Supplementary Targets for Designing Neurotherapeutics.ACS Chem Neurosci. 2019 Mar 20;10(3):1118-1120. doi: 10.1021/acschemneuro.9b00002. Epub 2019 Jan 18.
30 Decreased expression of autophagy-related proteins in malignant epithelial ovarian cancer.Autophagy. 2008 Nov;4(8):1067-8. doi: 10.4161/auto.6827. Epub 2008 Nov 20.
31 JWA inhibits melanoma angiogenesis by suppressing ILK signaling and is an independent prognostic biomarker for melanoma.Carcinogenesis. 2013 Dec;34(12):2778-88. doi: 10.1093/carcin/bgt318. Epub 2013 Sep 24.
32 Overexpression of the receptor for hyaluronan-mediated motility, correlates with expression of microtubule-associated protein in human oral squamous cell carcinomas.Int J Oncol. 2009 Jun;34(6):1565-71. doi: 10.3892/ijo_00000286.
33 Streptozotocin-Induced Autophagy Reduces Intracellular Insulin in Insulinoma INS-1E Cells.DNA Cell Biol. 2018 Mar;37(3):160-167. doi: 10.1089/dna.2017.3874. Epub 2018 Feb 27.
34 Autophagy protects cells from HCV-induced defects in lipid metabolism.Gastroenterology. 2012 Mar;142(3):644-653.e3. doi: 10.1053/j.gastro.2011.11.033. Epub 2011 Dec 7.
35 Pharmacological restoration of autophagy reduces hypertension-related stroke occurrence.Autophagy. 2020 Aug;16(8):1468-1481. doi: 10.1080/15548627.2019.1687215. Epub 2019 Nov 12.
36 Prognostic value of TIGAR and LC3B protein expression in nasopharyngeal carcinoma.Cancer Manag Res. 2018 Nov 12;10:5605-5616. doi: 10.2147/CMAR.S175501. eCollection 2018.
37 Autophagy promotes citrullination of VIM (vimentin) and its interaction with major histocompatibility complex class II in synovial fibroblasts.Autophagy. 2020 May;16(5):946-955. doi: 10.1080/15548627.2019.1664144. Epub 2019 Sep 8.
38 Autophagy Is Required for Activation of Pancreatic Stellate Cells, Associated With Pancreatic Cancer Progression and Promotes Growth of Pancreatic Tumors in Mice.Gastroenterology. 2017 May;152(6):1492-1506.e24. doi: 10.1053/j.gastro.2017.01.010. Epub 2017 Jan 23.
39 Expression of autophagy-associated proteins in papillary thyroid carcinoma.Oncol Lett. 2017 Jul;14(1):411-415. doi: 10.3892/ol.2017.6101. Epub 2017 Apr 28.
40 Recurrent nonsevere hypoglycemia exacerbates imbalance of mitochondrial homeostasis leading to synapse injury and cognitive deficit in diabetes.Am J Physiol Endocrinol Metab. 2018 Nov 1;315(5):E973-E986. doi: 10.1152/ajpendo.00133.2018. Epub 2018 Jul 3.
41 Lycium barbarum polysaccharide protects diabetic peripheral neuropathy by enhancing autophagy via mTOR/p70S6K inhibition in Streptozotocin-induced diabetic rats.J Chem Neuroanat. 2018 Apr;89:37-42. doi: 10.1016/j.jchemneu.2017.12.011. Epub 2017 Dec 30.
42 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
43 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
44 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
45 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
46 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
47 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
48 Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
49 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
50 Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
51 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
52 Labeling and identification of LNCaP cell surface proteins: a pilot study. Prostate. 2007 Jun 15;67(9):943-54. doi: 10.1002/pros.20580.