Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH1C8OJ)

• DOT Name: UDP-glucuronosyltransferase 1A1
• Synonyms: UGT1A1; EC 2.4.1.17; Bilirubin-specific UDPGT isozyme 1; hUG-BR1; UDP-glucuronosyltransferase 1-1; UDPGT 1-1; UGT1*1; UGT1-01; UGT1.1; UDP-glucuronosyltransferase 1A isoform 1
• Gene Name: UGT1A1
• Related Disease:
  Crigler-najjar syndrome type 1
  Crigler-Najjar syndrome type 2
  Gilbert syndrome
• UniProt ID: UD11_HUMAN
• EC Number: 2.4.1.17
• Pfam ID: PF00201
• Sequence:
  MAVESQGGRPLVLGLLLCVLGPVVSHAGKILLIPVDGSHWLSMLGAIQQLQQRGHEIVVL
  APDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDS
  AMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLE
  FEATQCPNPFSYVPRPLSSHSDHMTFLQRVKNMLIAFSQNFLCDVVYSPYATLASEFLQR
  EVTVQDLLSSASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH
  GIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDL
  LGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTS
  EDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHD
  LTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
• Function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol. Involved in the glucuronidation of bilirubin, a degradation product occurring in the normal catabolic pathway that breaks down heme in vertebrates. Also catalyzes the glucuronidation the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties. Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, a drug which can inhibit the effect of angiotensin II. Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan ; [Isoform 2]: Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
• Tissue Specificity: .Expressed in liver, colon and small intestine. Not expressed in kidney, esophagus and skin.; [Isoform 2]: Expressed in liver, colon, small intestine and kidney. Not expressed in esophagus and skin.
• KEGG Pathway:
  Pentose and glucuro.te interconversions (hsa00040)
  Ascorbate and aldarate metabolism (hsa00053)
  Steroid hormone biosynthesis (hsa00140)
  Retinol metabolism (hsa00830)
  Porphyrin metabolism (hsa00860)
  Metabolism of xenobiotics by cytochrome P450 (hsa00980)
  Drug metabolism - cytochrome P450 (hsa00982)
  Drug metabolism - other enzymes (hsa00983)
  Metabolic pathways (hsa01100)
  Biosynthesis of cofactors (hsa01240)
  Bile secretion (hsa04976)
  Chemical carcinogenesis - D. adducts (hsa05204)
  Chemical carcinogenesis - receptor activation (hsa05207)
• Reactome Pathway:
  Heme degradation (R-HSA-189483)
  Defective UGT1A1 causes hyperbilirubinemia (R-HSA-5579002)
  Aspirin ADME (R-HSA-9749641)
  Paracetamol ADME (R-HSA-9753281)
  Glucuronidation (R-HSA-156588)

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Crigler-najjar syndrome type 1	DISBEAZY	Definitive	Autosomal recessive	[1]
Crigler-Najjar syndrome type 2	DISB9PPH	Definitive	Autosomal recessive	[2]
Gilbert syndrome	DISMUZF4	Strong	Autosomal recessive	[3]

This DOT Affected the Drug Response of 6 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	UDP-glucuronosyltransferase 1A1 affects the response to substance of Cisplatin.	[59]
Vorinostat	DMWMPD4	Approved	UDP-glucuronosyltransferase 1A1 affects the response to substance of Vorinostat.	[61]
Atazanavir	DMSYRBX	Approved	UDP-glucuronosyltransferase 1A1 increases the Bone marrow toxicity ADR of Atazanavir.	[68]
Cimetidine	DMH61ZB	Approved	UDP-glucuronosyltransferase 1A1 increases the Haemolytic anaemia ADR of Cimetidine.	[69]
Pazopanib	DMF57DM	Approved	UDP-glucuronosyltransferase 1A1 increases the Hemorrhage ADR of Pazopanib.	[74]
Prochlorperazine	DM53SRA	Approved	UDP-glucuronosyltransferase 1A1 increases the Metabolic disorder ADR of Prochlorperazine.	[69]

This DOT Affected the Biotransformations of 43 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	UDP-glucuronosyltransferase 1A1 decreases the glucuronidation of Estradiol.	[60]
Diethylstilbestrol	DMN3UXQ	Approved	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Diethylstilbestrol.	[62]
Etoposide	DMNH3PG	Approved	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Etoposide.	[63]
Irinotecan	DMP6SC2	Approved	UDP-glucuronosyltransferase 1A1 decreases the glucuronidation of Irinotecan.	[60]
Ethinyl estradiol	DMODJ40	Approved	UDP-glucuronosyltransferase 1A1 decreases the glucuronidation of Ethinyl estradiol.	[60]
Capsaicin	DMGMF6V	Approved	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Capsaicin.	[64]
Ibuprofen	DM8VCBE	Approved	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Ibuprofen.	[65]
Estrone	DM5T6US	Approved	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Estrone.	[66]
Morphine	DMRMS0L	Approved	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Morphine.	[67]
Estriol	DMOEM2I	Approved	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Estriol.	[66]
Masoprocol	DMMVNZ0	Approved	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Masoprocol.	[64]
Flurbiprofen	DMGN4BY	Approved	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Flurbiprofen.	[65]
Carvedilol	DMHTEAO	Approved	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Carvedilol.	[70]
Entacapone	DMLBVKQ	Approved	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Entacapone.	[71]
Ofloxacin	DM0VQN3	Approved	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Ofloxacin.	[72]
Ezetimibe	DM7A8TW	Approved	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Ezetimibe.	[73]
Buprenorphine	DMPRI8G	Approved	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Buprenorphine.	[75]
LAROPIPRANT	DM5FABJ	Phase 4	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of LAROPIPRANT.	[76]
Ranirestat	DMD5QRS	Phase 3	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Ranirestat.	[77]
Muraglitazar	DMG3NFZ	Phase 3	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Muraglitazar.	[60]
Belinostat	DM6OC53	Phase 2	UDP-glucuronosyltransferase 1A1 decreases the glucuronidation of Belinostat.	[78]
Sitafloxacin	DMTV5XC	Phase 2	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Sitafloxacin.	[72]
Eugenol	DM7US1H	Patented	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Eugenol.	[64]
Steroid derivative 1	DMB0NVQ	Patented	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Steroid derivative 1.	[66]
Bropirimine	DMMT1YQ	Discontinued in Phase 3	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Bropirimine.	[80]
EMODIN	DMAEDQG	Terminated	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of EMODIN.	[64]
Coumestrol	DM40TBU	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Coumestrol.	[64]
Bilirubin	DMI0V4O	Investigative	UDP-glucuronosyltransferase 1A1 decreases the glucuronidation of Bilirubin.	[60]
Arachidonic acid	DMUOQZD	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Arachidonic acid.	[81]
Farnesol	DMV2X1B	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Farnesol.	[82]
3,7,3',4'-TETRAHYDROXYFLAVONE	DMES906	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of 3,7,3',4'-TETRAHYDROXYFLAVONE.	[64]
Galangin	DM5TQ2O	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Galangin.	[64]
Plumbagin	DM9BS50	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Plumbagin.	[64]
Formononetin	DM7WFZ8	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Formononetin.	[64]
Mononitrophenol	DM4QO9G	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Mononitrophenol.	[71]
2-hydroxy-17beta-estradiol	DMM9Z0B	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of 2-hydroxy-17beta-estradiol.	[83]
ACMC-1AKLT	DMRQ70X	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of ACMC-1AKLT.	[84]
20-HETE	DM5BAJ9	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of 20-HETE.	[81]
Hydroxyestrone	DMBO7ZD	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Hydroxyestrone.	[66]
BRN-1999480	DMC9Q4D	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of BRN-1999480.	[66]
Anthraflavic acid	DMN1YFU	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Anthraflavic acid.	[75]
SCOPOLETIN	DM645FP	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of SCOPOLETIN.	[71]
Quinizarin	DMRQCK3	Investigative	UDP-glucuronosyltransferase 1A1 increases the glucuronidation of Quinizarin.	[64]

This DOT Affected the Regulation of Drug Effects of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Puerarin	DMJIMXH	Phase 2	UDP-glucuronosyltransferase 1A1 increases the metabolism of Puerarin.	[79]
SN-38G	DM2UVNB	Investigative	UDP-glucuronosyltransferase 1A1 increases the abundance of SN-38G.	[85]

86 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of UDP-glucuronosyltransferase 1A1.	[4]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of UDP-glucuronosyltransferase 1A1.	[5]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of UDP-glucuronosyltransferase 1A1.	[6]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of UDP-glucuronosyltransferase 1A1.	[7]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of UDP-glucuronosyltransferase 1A1.	[8]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of UDP-glucuronosyltransferase 1A1.	[9]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of UDP-glucuronosyltransferase 1A1.	[9]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of UDP-glucuronosyltransferase 1A1.	[10]
Carbamazepine	DMZOLBI	Approved	Carbamazepine increases the expression of UDP-glucuronosyltransferase 1A1.	[11]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of UDP-glucuronosyltransferase 1A1.	[12]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of UDP-glucuronosyltransferase 1A1.	[13]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the expression of UDP-glucuronosyltransferase 1A1.	[14]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of UDP-glucuronosyltransferase 1A1.	[15]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of UDP-glucuronosyltransferase 1A1.	[16]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of UDP-glucuronosyltransferase 1A1.	[17]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of UDP-glucuronosyltransferase 1A1.	[17]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of UDP-glucuronosyltransferase 1A1.	[18]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of UDP-glucuronosyltransferase 1A1.	[18]
Indomethacin	DMSC4A7	Approved	Indomethacin decreases the activity of UDP-glucuronosyltransferase 1A1.	[19]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid increases the expression of UDP-glucuronosyltransferase 1A1.	[20]
Fenofibrate	DMFKXDY	Approved	Fenofibrate increases the expression of UDP-glucuronosyltransferase 1A1.	[17]
Rifampicin	DM5DSFZ	Approved	Rifampicin increases the expression of UDP-glucuronosyltransferase 1A1.	[21]
Sulindac	DM2QHZU	Approved	Sulindac increases the expression of UDP-glucuronosyltransferase 1A1.	[22]
Pioglitazone	DMKJ485	Approved	Pioglitazone increases the expression of UDP-glucuronosyltransferase 1A1.	[23]
Phenytoin	DMNOKBV	Approved	Phenytoin increases the expression of UDP-glucuronosyltransferase 1A1.	[24]
Ritonavir	DMU764S	Approved	Ritonavir affects the expression of UDP-glucuronosyltransferase 1A1.	[25]
Chenodiol	DMQ8JIK	Approved	Chenodiol increases the expression of UDP-glucuronosyltransferase 1A1.	[26]
Omeprazole	DM471KJ	Approved	Omeprazole increases the expression of UDP-glucuronosyltransferase 1A1.	[27]
Clotrimazole	DMMFCIH	Approved	Clotrimazole affects the expression of UDP-glucuronosyltransferase 1A1.	[25]
Nilotinib	DM7HXWT	Approved	Nilotinib decreases the activity of UDP-glucuronosyltransferase 1A1.	[28]
Naproxen	DMZ5RGV	Approved	Naproxen decreases the activity of UDP-glucuronosyltransferase 1A1.	[19]
Ketoprofen	DMRKXPT	Approved	Ketoprofen decreases the activity of UDP-glucuronosyltransferase 1A1.	[19]
Furosemide	DMMQ8ZG	Approved	Furosemide increases the expression of UDP-glucuronosyltransferase 1A1.	[18]
Gemfibrozil	DMD8Q3J	Approved	Gemfibrozil increases the expression of UDP-glucuronosyltransferase 1A1.	[29]
Osimertinib	DMRJLAT	Approved	Osimertinib decreases the activity of UDP-glucuronosyltransferase 1A1.	[30]
Niflumic acid	DMJ3I1Q	Approved	Niflumic acid decreases the activity of UDP-glucuronosyltransferase 1A1.	[19]
Flunitrazepam	DMGR5Z3	Approved	Flunitrazepam decreases the activity of UDP-glucuronosyltransferase 1A1.	[31]
Diflunisal	DM7EN8I	Approved	Diflunisal decreases the activity of UDP-glucuronosyltransferase 1A1.	[19]
Tucatinib	DMBESUA	Approved	Tucatinib decreases the activity of UDP-glucuronosyltransferase 1A1.	[32]
Opicapone	DM1BKA6	Approved	Opicapone decreases the activity of UDP-glucuronosyltransferase 1A1.	[33]
Isoflavone	DM7U58J	Phase 4	Isoflavone increases the expression of UDP-glucuronosyltransferase 1A1.	[34]
3,4-Dihydroxycinnamic Acid	DMVZL26	Phase 4	3,4-Dihydroxycinnamic Acid decreases the activity of UDP-glucuronosyltransferase 1A1.	[35]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of UDP-glucuronosyltransferase 1A1.	[36]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of UDP-glucuronosyltransferase 1A1.	[37]
EXISULIND	DMBY56U	Phase 3	EXISULIND increases the expression of UDP-glucuronosyltransferase 1A1.	[22]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of UDP-glucuronosyltransferase 1A1.	[38]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene decreases the expression of UDP-glucuronosyltransferase 1A1.	[15]
LM-94	DMW3QGJ	Phase 1/2	LM-94 increases the activity of UDP-glucuronosyltransferase 1A1.	[28]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of UDP-glucuronosyltransferase 1A1.	[39]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of UDP-glucuronosyltransferase 1A1.	[40]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of UDP-glucuronosyltransferase 1A1.	[41]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of UDP-glucuronosyltransferase 1A1.	[18]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 increases the expression of UDP-glucuronosyltransferase 1A1.	[42]
Ticrynafen	DMLFSTR	Withdrawn from market	Ticrynafen increases the expression of UDP-glucuronosyltransferase 1A1.	[18]
PIRINIXIC ACID	DM82Y75	Preclinical	PIRINIXIC ACID increases the expression of UDP-glucuronosyltransferase 1A1.	[43]
Taxifolin	DMQJSF9	Preclinical	Taxifolin increases the expression of UDP-glucuronosyltransferase 1A1.	[42]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of UDP-glucuronosyltransferase 1A1.	[44]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of UDP-glucuronosyltransferase 1A1.	[45]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of UDP-glucuronosyltransferase 1A1.	[46]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE increases the expression of UDP-glucuronosyltransferase 1A1.	[47]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of UDP-glucuronosyltransferase 1A1.	[45]
Chlorpyrifos	DMKPUI6	Investigative	Chlorpyrifos increases the expression of UDP-glucuronosyltransferase 1A1.	[48]
Cycloheximide	DMGDA3C	Investigative	Cycloheximide decreases the expression of UDP-glucuronosyltransferase 1A1.	[15]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate increases the expression of UDP-glucuronosyltransferase 1A1.	[48]
Rutin	DMEHRAJ	Investigative	Rutin increases the expression of UDP-glucuronosyltransferase 1A1.	[21]
Chrysin	DM7V2LG	Investigative	Chrysin increases the expression of UDP-glucuronosyltransferase 1A1.	[49]
Kaempferol	DMHEMUB	Investigative	Kaempferol decreases the activity of UDP-glucuronosyltransferase 1A1.	[50]
CATECHIN	DMY38SB	Investigative	CATECHIN decreases the activity of UDP-glucuronosyltransferase 1A1.	[35]
Daidzein	DMRFTJX	Investigative	Daidzein increases the activity of UDP-glucuronosyltransferase 1A1.	[51]
(E)-4-(3,5-dimethoxystyryl)phenol	DMYXI2V	Investigative	(E)-4-(3,5-dimethoxystyryl)phenol decreases the activity of UDP-glucuronosyltransferase 1A1.	[52]
Apigenin	DMI3491	Investigative	Apigenin increases the expression of UDP-glucuronosyltransferase 1A1.	[53]
biochanin A	DM0HPWY	Investigative	biochanin A increases the expression of UDP-glucuronosyltransferase 1A1.	[34]
Myricetin	DMTV4L0	Investigative	Myricetin decreases the activity of UDP-glucuronosyltransferase 1A1.	[50]
Chlorogenic acid	DM2Y3P4	Investigative	Chlorogenic acid decreases the activity of UDP-glucuronosyltransferase 1A1.	[35]
Morin	DM2OGZ5	Investigative	Morin decreases the activity of UDP-glucuronosyltransferase 1A1.	[50]
MANGIFERIN	DMWAF5Z	Investigative	MANGIFERIN increases the expression of UDP-glucuronosyltransferase 1A1.	[54]
P-Coumaric Acid	DMGJSVD	Investigative	P-Coumaric Acid decreases the activity of UDP-glucuronosyltransferase 1A1.	[35]
Hyperforin	DM2L3PE	Investigative	Hyperforin increases the expression of UDP-glucuronosyltransferase 1A1.	[55]
Fibrates	DMFNTMY	Investigative	Fibrates increases the expression of UDP-glucuronosyltransferase 1A1.	[29]
Phloretin	DMYA50U	Investigative	Phloretin decreases the activity of UDP-glucuronosyltransferase 1A1.	[35]
Acacetin	DMQOB0X	Investigative	Acacetin increases the expression of UDP-glucuronosyltransferase 1A1.	[34]
AMENTOFLAVONE	DMLRNV2	Investigative	AMENTOFLAVONE decreases the activity of UDP-glucuronosyltransferase 1A1.	[56]
pregnenolone-16alpha-carbonitrile	DM0LW7G	Investigative	pregnenolone-16alpha-carbonitrile increases the expression of UDP-glucuronosyltransferase 1A1.	[57]
Phlorizin	DMNARGO	Investigative	Phlorizin decreases the activity of UDP-glucuronosyltransferase 1A1.	[35]
GINKGOLIDE A	DMKZJ7T	Investigative	GINKGOLIDE A increases the expression of UDP-glucuronosyltransferase 1A1.	[58]
ROBINETIN	DMASOWP	Investigative	ROBINETIN increases the expression of UDP-glucuronosyltransferase 1A1.	[42]

References

• [1] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [2] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [3] UGT1A1 genetic analysis as a diagnostic aid for individuals with unconjugated hyperbilirubinemia. J Pediatr. 2013 Jun;162(6):1146-52, 1152.e1-2. doi: 10.1016/j.jpeds.2012.11.042. Epub 2013 Jan 4.
• [4] Histone deacetylase inhibitor valproic acid promotes the differentiation of human induced pluripotent stem cells into hepatocyte-like cells. PLoS One. 2014 Aug 1;9(8):e104010.
• [5] Impairment of bile acid metabolism by perfluorooctanoic acid (PFOA) and perfluorooctanesulfonic acid (PFOS) in human HepaRG hepatoma cells. Arch Toxicol. 2020 May;94(5):1673-1686. doi: 10.1007/s00204-020-02732-3. Epub 2020 Apr 6.
• [6] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [7] Cadmium and arsenic override NF-B developmental regulation of the intestinal UGT1A1 gene and control of hyperbilirubinemia. Biochem Pharmacol. 2016 Jun 15;110-111:37-46.
• [8] Absorption/metabolism of sulforaphane and quercetin, and regulation of phase II enzymes, in human jejunum in vivo. Drug Metab Dispos. 2003 Jun;31(6):805-13. doi: 10.1124/dmd.31.6.805.
• [9] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [10] Triclosan treatment decreased the antitumor effect of sorafenib on hepatocellular carcinoma cells. Onco Targets Ther. 2018 May 18;11:2945-2954.
• [11] Induction of the UDP-glucuronosyltransferase 1A1 during the perinatal period can cause neurodevelopmental toxicity. Mol Pharmacol. 2016 Sep;90(3):265-74.
• [12] UDP-glucuronosyltransferase 1A6 overexpression in breast cancer cells resistant to methotrexate. Biochem Pharmacol. 2011 Jan 1;81(1):60-70.
• [13] Epigenetic regulation is a crucial factor in the repression of UGT1A1 expression in the human kidney. Drug Metab Dispos. 2013 Oct;41(10):1738-43.
• [14] Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
• [15] Estrogen regulation in human breast cancer cells of new downstream gene targets involved in estrogen metabolism, cell proliferation and cell transformation. J Mol Endocrinol. 2004 Apr;32(2):397-414.
• [16] Transcriptional regulation of human UGT1A1 gene expression: activated glucocorticoid receptor enhances constitutive androstane receptor/pregnane X receptor-mediated UDP-glucuronosyltransferase 1A1 regulation with glucocorticoid receptor-interacting protein 1. Mol Pharmacol. 2005 Mar;67(3):845-55.
• [17] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [18] Markers of electrophilic stress caused by chemically reactive metabolites in human hepatocytes. Drug Metab Dispos. 2008 May;36(5):816-23.
• [19] In vitro inhibitory effects of non-steroidal antiinflammatory drugs on UDP-glucuronosyltransferase 1A1-catalysed estradiol 3beta-glucuronidation in human liver microsomes. Biopharm Drug Dispos. 2005 Jan;26(1):35-9.
• [20] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [21] The induction of human UDP-glucuronosyltransferase 1A1 mediated through a distal enhancer module by flavonoids and xenobiotics. Biochem Pharmacol. 2004 Mar 1;67(5):989-1000.
• [22] Sulindac and its metabolites induce carcinogen metabolizing enzymes in human colon cancer cells. Int J Cancer. 2008 Mar 1;122(5):990-8.
• [23] A comprehensive evaluation of anti-diabetic drugs on nuclear receptor PXR platform. Toxicol In Vitro. 2019 Oct;60:347-358.
• [24] Expression and inducibility of the human bilirubin UDP-glucuronosyltransferase UGT1A1 in liver and cultured primary hepatocytes: evidence for both genetic and environmental influences. Hepatology. 1999 Aug;30(2):476-84.
• [25] Modulation of UDP-glucuronosyltransferase 1A1 in primary human hepatocytes by prototypical inducers. J Biochem Mol Toxicol. 2005;19(2):96-108. doi: 10.1002/jbt.20058.
• [26] Chenodeoxycholic acid significantly impacts the expression of miRNAs and genes involved in lipid, bile acid and drug metabolism in human hepatocytes. Life Sci. 2016 Jul 1;156:47-56.
• [27] Use of mRNA expression to detect the induction of drug metabolising enzymes in rat and human hepatocytes. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):86-96.
• [28] Assessment of the inhibition potential of Licochalcone A against human UDP-glucuronosyltransferases. Food Chem Toxicol. 2016 Apr;90:112-22.
• [29] Comparative effects of fibrates on drug metabolizing enzymes in human hepatocytes. Pharm Res. 2005 Jan;22(1):71-8.
• [30] In vitro inhibition of human UDP-glucuronosyltransferase (UGT) 1A1 by osimertinib, and prediction of in vivo drug-drug interactions. Toxicol Lett. 2021 Sep 15;348:10-17. doi: 10.1016/j.toxlet.2021.05.004. Epub 2021 May 24.
• [31] Identification of human UDP-glucuronosyltransferase enzyme(s) responsible for the glucuronidation of 3-hydroxydesloratadine. Biopharm Drug Dispos. 2004 Sep;25(6):243-52.
• [32] Drug-drug interaction potentials of tucatinib inhibition of human UDP-glucuronosyltransferases. Chem Biol Interact. 2023 Aug 25;381:110574. doi: 10.1016/j.cbi.2023.110574. Epub 2023 May 30.
• [33] In vitro effects of opicapone on activity of human UDP-glucuronosyltransferases isoforms. Toxicol Lett. 2022 Aug 15;367:3-8. doi: 10.1016/j.toxlet.2022.07.003. Epub 2022 Jul 8.
• [34] Isoflavones as Ah Receptor Agonists in Colon-Derived Cell Lines: Structure-Activity Relationships. Chem Res Toxicol. 2019 Nov 18;32(11):2353-2364. doi: 10.1021/acs.chemrestox.9b00352. Epub 2019 Oct 29.
• [35] Phloretin exhibits potential food-drug interactions by inhibiting human UDP-glucuronosyltransferases in vitro. Toxicol In Vitro. 2022 Oct;84:105447. doi: 10.1016/j.tiv.2022.105447. Epub 2022 Jul 19.
• [36] Resveratrol in human hepatoma HepG2 cells: metabolism and inducibility of detoxifying enzymes. Drug Metab Dispos. 2007 May;35(5):699-703.
• [37] Turmeric and curcumin modulate the conjugation of 1-naphthol in Caco-2 cells. Biol Pharm Bull. 2006 Jul;29(7):1476-9.
• [38] Effects of endocrine disruptors on genes associated with 17beta-estradiol metabolism and excretion. Steroids. 2008 Nov;73(12):1242-51.
• [39] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [40] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [41] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [42] Structure-dependent modulation of aryl hydrocarbon receptor-mediated activities by flavonoids. Toxicol Sci. 2018 Jul 1;164(1):205-217.
• [43] Expression of the human UGT1 locus in transgenic mice by 4-chloro-6-(2,3-xylidino)-2-pyrimidinylthioacetic acid (WY-14643) and implications on drug metabolism through peroxisome proliferator-activated receptor alpha activation. Drug Metab Dispos. 2007 Mar;35(3):419-27.
• [44] Bisphenol A and its analogues activate human pregnane X receptor. Environ Health Perspect. 2012 Mar;120(3):399-405.
• [45] Butyrate interacts with benzo[a]pyrene to alter expression and activities of xenobiotic metabolizing enzymes involved in metabolism of carcinogens within colon epithelial cell models. Toxicology. 2019 Jan 15;412:1-11.
• [46] Sulforaphane and quercetin modulate PhIP-DNA adduct formation in human HepG2 cells and hepatocytes. Carcinogenesis. 2003 Dec;24(12):1903-11.
• [47] Protective effects of xanthohumol against the genotoxicity of heterocyclic aromatic amines MeIQx and PhIP in bacteria and in human hepatoma (HepG2) cells. Food Chem Toxicol. 2012 Mar;50(3-4):949-55.
• [48] In vitro and in silico assessment of endocrine disrupting effects of food contaminants through pregnane X receptor. Food Chem Toxicol. 2023 May;175:113711. doi: 10.1016/j.fct.2023.113711. Epub 2023 Mar 7.
• [49] Induction of UDP-glucuronosyltransferase UGT1A1 by the flavonoid chrysin in the human hepatoma cell line hep G2. Drug Metab Dispos. 2000 Sep;28(9):1077-82.
• [50] Potential interactions among myricetin and dietary flavonols through the inhibition of human UDP-glucuronosyltransferase in vitro. Toxicol Lett. 2022 Apr 1;358:40-47. doi: 10.1016/j.toxlet.2022.01.007. Epub 2022 Jan 19.
• [51] Isoflavones modulate the glucuronidation of estradiol in human liver microsomes. Carcinogenesis. 2005 Dec;26(12):2172-8.
• [52] Pterostilbene supplements carry the risk of drug interaction via inhibition of UDP-glucuronosyltransferases (UGT) 1A9 enzymes. Toxicol Lett. 2020 Mar 1;320:46-51. doi: 10.1016/j.toxlet.2019.12.008. Epub 2019 Dec 5.
• [53] Interactions between sulforaphane and apigenin in the induction of UGT1A1 and GSTA1 in CaCo-2 cells. Carcinogenesis. 2004 Sep;25(9):1629-37.
• [54] Mangifera indica Lextract and mangiferin modulate cytochrome P450 and UDP-glucuronosyltransferase enzymes in primary cultures of human hepatocytes. Phytother Res. 2013 May;27(5):745-52.
• [55] No activation of human pregnane X receptor by hyperforin-related phloroglucinols. J Pharmacol Exp Ther. 2014 Mar;348(3):393-400.
• [56] Amentoflavone is a potent broad-spectrum inhibitor of human UDP-glucuronosyltransferases. Chem Biol Interact. 2018 Mar 25;284:48-55.
• [57] Tissue-specific, inducible, and hormonal control of the human UDP-glucuronosyltransferase-1 (UGT1) locus. J Biol Chem. 2005 Nov 11;280(45):37547-57.
• [58] Bioactive terpenoids and flavonoids from Ginkgo biloba extract induce the expression of hepatic drug-metabolizing enzymes through pregnane X receptor, constitutive androstane receptor, and aryl hydrocarbon receptor-mediated pathways. Pharm Res. 2009 Apr;26(4):872-82.
• [59] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [60] Characterization of the UDP glucuronosyltransferase activity of human liver microsomes genotyped for the UGT1A1*28 polymorphism. Drug Metab Dispos. 2007 Dec;35(12):2270-80.
• [61] Vorinostat: A novel therapy for the treatment of cutaneous T-cell lymphoma. Am J Health Syst Pharm. 2010 May 15;67(10):793-7. doi: 10.2146/ajhp090247.
• [62] Characterization of UDP-glucuronosyltransferases involved in glucuronidation of diethylstilbestrol in human liver and intestine. Chem Res Toxicol. 2012 Dec 17;25(12):2663-9. doi: 10.1021/tx300310k. Epub 2012 Nov 13.
• [63] UDP-glucuronosyltransferase 1A1 is the principal enzyme responsible for etoposide glucuronidation in human liver and intestinal microsomes: structural characterization of phenolic and alcoholic glucuronides of etoposide and estimation of enzyme kinetics. Drug Metab Dispos. 2007 Mar;35(3):371-80.
• [64] Differential and special properties of the major human UGT1-encoded gastrointestinal UDP-glucuronosyltransferases enhance potential to control chemical uptake. J Biol Chem. 2004 Jan 9;279(2):1429-41.
• [65] Glucuronidation of nonsteroidal anti-inflammatory drugs: identifying the enzymes responsible in human liver microsomes. Drug Metab Dispos. 2005 Jul;33(7):1027-35.
• [66] Gastrointestinally distributed UDP-glucuronosyltransferase 1A10, which metabolizes estrogens and nonsteroidal anti-inflammatory drugs, depends upon phosphorylation. J Biol Chem. 2004 Jul 2;279(27):28320-9. doi: 10.1074/jbc.M401396200. Epub 2004 Apr 26.
• [67] Isoform selectivity and kinetics of morphine 3- and 6-glucuronidation by human udp-glucuronosyltransferases: evidence for atypical glucuronidation kinetics by UGT2B7. Drug Metab Dispos. 2003 Sep;31(9):1086-9. doi: 10.1124/dmd.31.9.1086.
• [68] Clinical Pharmacogenetics Implementation Consortium (CPIC) Guideline for UGT1A1 and Atazanavir Prescribing. Clin Pharmacol Ther. 2016 Apr;99(4):363-9. doi: 10.1002/cpt.269. Epub 2015 Nov 9.
• [69] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
• [70] Involvement of human hepatic UGT1A1, UGT2B4, and UGT2B7 in the glucuronidation of carvedilol. Drug Metab Dispos. 2004 Feb;32(2):235-9. doi: 10.1124/dmd.32.2.235.
• [71] Kinetic characterization of the 1A subfamily of recombinant human UDP-glucuronosyltransferases. Drug Metab Dispos. 2005 Jul;33(7):1017-26.
• [72] Acyl glucuronidation of fluoroquinolone antibiotics by the UDP-glucuronosyltransferase 1A subfamily in human liver microsomes. Drug Metab Dispos. 2005 Jun;33(6):803-11. doi: 10.1124/dmd.104.003178. Epub 2005 Mar 15.
• [73] Identification of human UDP-glucuronosyltransferase enzyme(s) responsible for the glucuronidation of ezetimibe (Zetia). Drug Metab Dispos. 2004 Mar;32(3):314-20.
• [74] Pazopanib-induced hyperbilirubinemia is associated with Gilbert's syndrome UGT1A1 polymorphism. Br J Cancer. 2010 Apr 27;102(9):1371-7. doi: 10.1038/sj.bjc.6605653. Epub 2010 Apr 13.
• [75] The effect of incubation conditions on the enzyme kinetics of udp-glucuronosyltransferases. Drug Metab Dispos. 2003 Jun;31(6):762-7. doi: 10.1124/dmd.31.6.762.
• [76] Metabolism of MK-0524, a prostaglandin D2 receptor 1 antagonist, in microsomes and hepatocytes from preclinical species and humans. Drug Metab Dispos. 2007 Feb;35(2):283-92. doi: 10.1124/dmd.106.011551. Epub 2006 Nov 28.
• [77] Uridine diphosphate sugar-selective conjugation of an aldose reductase inhibitor (AS-3201) by UDP-glucuronosyltransferase 2B subfamily in human liver microsomes. Biochem Pharmacol. 2004 Apr 1;67(7):1269-78. doi: 10.1016/j.bcp.2003.11.010.
• [78] Glucuronidation by UGT1A1 is the dominant pathway of the metabolic disposition of belinostat in liver cancer patients. PLoS One. 2013;8(1):e54522.
• [79] UDP-glucuronosyltransferase 1A1 is the principal enzyme responsible for puerarin metabolism in human liver microsomes. Arch Toxicol. 2012 Nov;86(11):1681-90. doi: 10.1007/s00204-012-0874-7. Epub 2012 May 31.
• [80] Characterization of bropirimine O-glucuronidation in human liver microsomes. Xenobiotica. 2003 Oct;33(10):999-1011. doi: 10.1080/00498250310001602757.
• [81] Glucuronidation of oxidized fatty acids and prostaglandins B1 and E2 by human hepatic and recombinant UDP-glucuronosyltransferases. J Lipid Res. 2004 Sep;45(9):1694-703. doi: 10.1194/jlr.M400103-JLR200. Epub 2004 Jul 1.
• [82] Farnesol is glucuronidated in human liver, kidney and intestine in vitro, and is a novel substrate for UGT2B7 and UGT1A1. Biochem J. 2004 Dec 15;384(Pt 3):637-45. doi: 10.1042/BJ20040997.
• [83] The functional UGT1A1 promoter polymorphism decreases endometrial cancer risk. Cancer Res. 2004 Feb 1;64(3):1202-7. doi: 10.1158/0008-5472.can-03-3295.
• [84] Silybin inactivates cytochromes P450 3A4 and 2C9 and inhibits major hepatic glucuronosyltransferases. Drug Metab Dispos. 2004 Jun;32(6):587-94.
• [85] Effects of common genetic variants of human uridine diphosphate glucuronosyltransferase subfamilies on irinotecan glucuronidation. Toxicol Mech Methods. 2023 Mar;33(3):197-205. doi: 10.1080/15376516.2022.2109229. Epub 2022 Aug 23.