Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIP1UFX)

• DOT Name: Krueppel-like factor 2 (KLF2)
• Synonyms: Lung krueppel-like factor
• Gene Name: KLF2
• Related Disease:
  Breast cancer
  Breast carcinoma
  Liver cirrhosis
  Lymphoma
  Alzheimer disease
  Autoimmune disease
  B-cell neoplasm
  Bone osteosarcoma
  Breast neoplasm
  Cardiac failure
  Cerebral cavernous malformation
  Chronic obstructive pulmonary disease
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Colorectal neoplasm
  Congestive heart failure
  Coronary heart disease
  Epithelial ovarian cancer
  Glioma
  Hairy cell leukaemia
  Hepatocellular carcinoma
  Hyperglycemia
  leukaemia
  Leukemia
  Lung cancer
  Lung carcinoma
  Neoplasm
  Osteoarthritis
  Osteosarcoma
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic cancer
  Plasma cell myeloma
  Rheumatoid arthritis
  Splenic marginal zone lymphoma
  Tuberculosis
  Type-1/2 diabetes
  Ulcerative colitis
  Diabetic kidney disease
  Stroke
  Advanced cancer
  Arthritis
  Cardiovascular disease
  Coronary atherosclerosis
  Gastric cancer
  Pulmonary arterial hypertension
  Pulmonary disease
  Stomach cancer
• UniProt ID: KLF2_HUMAN
• Pfam ID: PF00096
• Sequence:
  MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEA
  APEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRL
  VKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDG
  PARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAAR
  GLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEK
  PYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM
• Function: Transcription factor that binds to the CACCC box in the promoter of target genes such as HBB/beta globin or NOV and activates their transcription. Might be involved in transcriptional regulation by modulating the binding of the RARA nuclear receptor to RARE DNA elements.
• KEGG Pathway:
  FoxO sig.ling pathway (hsa04068)
  Apelin sig.ling pathway (hsa04371)
  Fluid shear stress and atherosclerosis (hsa05418)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Definitive	Biomarker	[1]
Breast carcinoma	DIS2UE88	Definitive	Biomarker	[1]
Liver cirrhosis	DIS4G1GX	Definitive	Altered Expression	[2]
Lymphoma	DISN6V4S	Definitive	Altered Expression	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Autoimmune disease	DISORMTM	Strong	Biomarker	[5]
B-cell neoplasm	DISVY326	Strong	Altered Expression	[6]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[7]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[8]
Cardiac failure	DISDC067	Strong	Biomarker	[9]
Cerebral cavernous malformation	DISLKNYA	Strong	Biomarker	[10]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Altered Expression	[11]
Colon cancer	DISVC52G	Strong	Biomarker	[12]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[12]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[13]
Colorectal neoplasm	DISR1UCN	Strong	Biomarker	[13]
Congestive heart failure	DIS32MEA	Strong	Altered Expression	[9]
Coronary heart disease	DIS5OIP1	Strong	Genetic Variation	[14]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[15]
Glioma	DIS5RPEH	Strong	Biomarker	[16]
Hairy cell leukaemia	DISTD2E5	Strong	Genetic Variation	[17]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[18]
Hyperglycemia	DIS0BZB5	Strong	Biomarker	[19]
leukaemia	DISS7D1V	Strong	Biomarker	[20]
Leukemia	DISNAKFL	Strong	Biomarker	[20]
Lung cancer	DISCM4YA	Strong	Biomarker	[21]
Lung carcinoma	DISTR26C	Strong	Biomarker	[21]
Neoplasm	DISZKGEW	Strong	Biomarker	[22]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[23]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[7]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[15]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[15]
Pancreatic cancer	DISJC981	Strong	Biomarker	[24]
Plasma cell myeloma	DIS0DFZ0	Strong	Genetic Variation	[25]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[26]
Splenic marginal zone lymphoma	DISCGTZY	Strong	Biomarker	[27]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[28]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[29]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[30]
Diabetic kidney disease	DISJMWEY	moderate	Altered Expression	[31]
Stroke	DISX6UHX	moderate	Biomarker	[32]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[33]
Arthritis	DIST1YEL	Limited	Biomarker	[26]
Cardiovascular disease	DIS2IQDX	Limited	Genetic Variation	[34]
Coronary atherosclerosis	DISKNDYU	Limited	Genetic Variation	[35]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[36]
Pulmonary arterial hypertension	DISP8ZX5	Limited	Autosomal dominant	[37]
Pulmonary disease	DIS6060I	Limited	Biomarker	[38]
Stomach cancer	DISKIJSX	Limited	Altered Expression	[36]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Krueppel-like factor 2 (KLF2).	[39]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Krueppel-like factor 2 (KLF2).	[54]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Krueppel-like factor 2 (KLF2).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Krueppel-like factor 2 (KLF2).	[41]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Krueppel-like factor 2 (KLF2).	[42]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Krueppel-like factor 2 (KLF2).	[43]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Krueppel-like factor 2 (KLF2).	[44]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Krueppel-like factor 2 (KLF2).	[45]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Krueppel-like factor 2 (KLF2).	[46]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Krueppel-like factor 2 (KLF2).	[47]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Krueppel-like factor 2 (KLF2).	[48]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Krueppel-like factor 2 (KLF2).	[49]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Krueppel-like factor 2 (KLF2).	[50]
Simvastatin	DM30SGU	Approved	Simvastatin increases the expression of Krueppel-like factor 2 (KLF2).	[51]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Krueppel-like factor 2 (KLF2).	[52]
Coprexa	DMA0WEK	Phase 3	Coprexa decreases the expression of Krueppel-like factor 2 (KLF2).	[53]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Krueppel-like factor 2 (KLF2).	[55]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Krueppel-like factor 2 (KLF2).	[56]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Krueppel-like factor 2 (KLF2).	[57]
GGTI-298	DM1CG0J	Terminated	GGTI-298 increases the expression of Krueppel-like factor 2 (KLF2).	[58]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Krueppel-like factor 2 (KLF2).	[59]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Krueppel-like factor 2 (KLF2).	[60]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Krueppel-like factor 2 (KLF2).	[61]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Krueppel-like factor 2 (KLF2).	[62]
Rapamycin Immunosuppressant Drug	DM678IB	Investigative	Rapamycin Immunosuppressant Drug increases the expression of Krueppel-like factor 2 (KLF2).	[62]
Tributylstannanyl	DMHN7CB	Investigative	Tributylstannanyl increases the expression of Krueppel-like factor 2 (KLF2).	[62]
(E)-4-(3,5-dimethoxystyryl)phenol	DMYXI2V	Investigative	(E)-4-(3,5-dimethoxystyryl)phenol increases the expression of Krueppel-like factor 2 (KLF2).	[63]
Dorsomorphin	DMKYXJW	Investigative	Dorsomorphin decreases the expression of Krueppel-like factor 2 (KLF2).	[52]

References

• [1] LncRNA RUSC1-AS1 promotes the proliferation of breast cancer cells by epigenetic silence of KLF2 and CDKN1A.Eur Rev Med Pharmacol Sci. 2019 Aug;23(15):6602-6611. doi: 10.26355/eurrev_201908_18548.
• [2] KLF2 exerts antifibrotic and vasoprotective effects in cirrhotic rat livers: behind the molecular mechanisms of statins.Gut. 2015 Sep;64(9):1434-43. doi: 10.1136/gutjnl-2014-308338. Epub 2014 Dec 10.
• [3] Ribosomal Protein Rpl22 Controls the Dissemination of T-cell Lymphoma.Cancer Res. 2016 Jun 1;76(11):3387-96. doi: 10.1158/0008-5472.CAN-15-2698. Epub 2016 Apr 5.
• [4] MicroRNA-25 aggravates A1-42-induced hippocampal neuron injury in Alzheimer's disease by downregulating KLF2 via the Nrf2 signaling pathway in a mouse model.J Cell Biochem. 2019 Sep;120(9):15891-15905. doi: 10.1002/jcb.28861. Epub 2019 May 29.
• [5] miRNA92a targets KLF2 and the phosphatase PTEN signaling to promote human T follicular helper precursors in T1D islet autoimmunity.Proc Natl Acad Sci U S A. 2016 Oct 25;113(43):E6659-E6668. doi: 10.1073/pnas.1606646113. Epub 2016 Oct 10.
• [6] Downregulated microRNA-92a-3p inhibits apoptosis and promotes proliferation of pancreatic acinar cells in acute pancreatitis by enhancing KLF2 expression.J Cell Biochem. 2020 Aug;121(8-9):3739-3751. doi: 10.1002/jcb.29517. Epub 2019 Nov 12.
• [7] CircRNA LRP6 promotes the development of osteosarcoma via negatively regulating KLF2 and APC levels.Am J Transl Res. 2019 Jul 15;11(7):4126-4138. eCollection 2019.
• [8] Silencing of Kruppel-like factor 2 by the histone methyltransferase EZH2 in human cancer.Oncogene. 2012 Apr 12;31(15):1988-94. doi: 10.1038/onc.2011.387. Epub 2011 Sep 5.
• [9] KLF2 mediates enhanced chemoreflex sensitivity, disordered breathing and autonomic dysregulation in heart failure.J Physiol. 2018 Aug;596(15):3171-3185. doi: 10.1113/JP273805. Epub 2017 Oct 11.
• [10] CDC42 Deletion Elicits Cerebral Vascular Malformations via Increased MEKK3-Dependent KLF4 Expression.Circ Res. 2019 Apr 12;124(8):1240-1252. doi: 10.1161/CIRCRESAHA.118.314300.
• [11] Abrogation of anti-inflammatory transcription factor LKLF in neutrophil-dominated airways.Am J Respir Cell Mol Biol. 2008 Jun;38(6):679-88. doi: 10.1165/rcmb.2007-0282OC. Epub 2008 Jan 24.
• [12] Kruppel-like factor 2 mediated anti-proliferative and anti-metastasis effects of simvastatin in p53 mutant colon cancer.Biochem Biophys Res Commun. 2019 Apr 16;511(4):772-779. doi: 10.1016/j.bbrc.2019.02.127. Epub 2019 Mar 2.
• [13] Discovery of common and rare genetic risk variants for colorectal cancer.Nat Genet. 2019 Jan;51(1):76-87. doi: 10.1038/s41588-018-0286-6. Epub 2018 Dec 3.
• [14] Genetic variant at coronary artery disease and ischemic stroke locus 1p32.2 regulates endothelial responses to hemodynamics.Proc Natl Acad Sci U S A. 2018 Nov 27;115(48):E11349-E11358. doi: 10.1073/pnas.1810568115. Epub 2018 Nov 14.
• [15] LINC00702 accelerates the progression of ovarian cancer through interacting with EZH2 to inhibit the transcription of KLF2.Eur Rev Med Pharmacol Sci. 2019 Aug;23(3 Suppl):201-208. doi: 10.26355/eurrev_201908_18648.
• [16] LncRNA SNHG3 enhances the malignant progress of glioma through silencing KLF2 and p21.Biosci Rep. 2018 Sep 7;38(5):BSR20180420. doi: 10.1042/BSR20180420. Print 2018 Oct 31.
• [17] Genomics of Hairy Cell Leukemia.J Clin Oncol. 2017 Mar 20;35(9):1002-1010. doi: 10.1200/JCO.2016.71.1556. Epub 2017 Feb 13.
• [18] Krppel-like factor 2 inhibits hepatocarcinogenesis through negative regulation of the Hedgehog pathway.Cancer Sci. 2019 Apr;110(4):1220-1231. doi: 10.1111/cas.13961. Epub 2019 Mar 4.
• [19] Low-dose phloretin alleviates diabetic atherosclerosis through endothelial KLF2 restoration.Biosci Biotechnol Biochem. 2020 Apr;84(4):815-823. doi: 10.1080/09168451.2019.1699396. Epub 2019 Dec 3.
• [20] Genomic and transcriptome analysis revealing an oncogenic functional module in meningiomas.Neurosurg Focus. 2013 Dec;35(6):E3. doi: 10.3171/2013.10.FOCUS13326.
• [21] Smurf1 ubiquitin ligase targets Kruppel-like factor KLF2 for ubiquitination and degradation in human lung cancer H1299 cells.Biochem Biophys Res Commun. 2011 Apr 1;407(1):254-9. doi: 10.1016/j.bbrc.2011.03.016. Epub 2011 Mar 5.
• [22] KLF2 Inhibits the Migration and Invasion of Prostate Cancer Cells by Downregulating MMP2.Am J Mens Health. 2019 Jan-Feb;13(1):1557988318816907. doi: 10.1177/1557988318816907. Epub 2018 Dec 6.
• [23] KLF2 Protects against Osteoarthritis by Repressing Oxidative Response through Activation of Nrf2/ARE Signaling In Vitro and In Vivo.Oxid Med Cell Longev. 2019 Nov 19;2019:8564681. doi: 10.1155/2019/8564681. eCollection 2019.
• [24] Long non-coding RNA IRAIN suppresses apoptosis and promotes proliferation by binding to LSD1 and EZH2 in pancreatic cancer.Tumour Biol. 2016 Nov;37(11):14929-14937. doi: 10.1007/s13277-016-5380-8. Epub 2016 Sep 19.
• [25] Identification of multiple risk loci and regulatory mechanisms influencing susceptibility to multiple myeloma.Nat Commun. 2018 Sep 13;9(1):3707. doi: 10.1038/s41467-018-04989-w.
• [26] Induction of Krppel-like factor 2 reduces K/BxN serum-induced arthritis.J Cell Mol Med. 2019 Feb;23(2):1386-1395. doi: 10.1111/jcmm.14041. Epub 2018 Dec 3.
• [27] Splenic marginal zone lymphoma: from genetics to management.Blood. 2016 Apr 28;127(17):2072-81. doi: 10.1182/blood-2015-11-624312. Epub 2016 Mar 17.
• [28] Diagnostic accuracy of a selected signature gene set that discriminates active pulmonary tuberculosis and other pulmonary diseases.J Infect. 2017 Dec;75(6):499-510. doi: 10.1016/j.jinf.2017.09.012. Epub 2017 Sep 20.
• [29] MiRNA-92a protects pancreatic B-cell function by targeting KLF2 in diabetes mellitus.Biochem Biophys Res Commun. 2018 Jun 7;500(3):577-582. doi: 10.1016/j.bbrc.2018.04.097.
• [30] KFL2 participates in the development of ulcerative colitis through inhibiting inflammation via regulating cytokines.Eur Rev Med Pharmacol Sci. 2018 Aug;22(15):4941-4948. doi: 10.26355/eurrev_201808_15633.
• [31] Role of Krppel-like factor-2 in kidney disease.Nephrology (Carlton). 2018 Oct;23 Suppl 4:53-56. doi: 10.1111/nep.13456.
• [32] Kruppel-like factor 2 protects against ischemic stroke by regulating endothelial blood brain barrier function.Am J Physiol Heart Circ Physiol. 2013 Mar 15;304(6):H796-805. doi: 10.1152/ajpheart.00712.2012. Epub 2013 Jan 18.
• [33] Downregulation of Kruppel-like factor 2 is associated with poor prognosis for nonsmall-cell lung cancer.Tumour Biol. 2015 Apr;36(4):3075-84. doi: 10.1007/s13277-014-2943-4. Epub 2014 Dec 14.
• [34] PEGylated gold nanorods are not cytotoxic to human endothelial cells but affect kruppel-like factor signaling pathway.Toxicol Appl Pharmacol. 2019 Nov 1;382:114758. doi: 10.1016/j.taap.2019.114758. Epub 2019 Sep 12.
• [35] IRF2BP2 Reduces Macrophage Inflammation and Susceptibility to Atherosclerosis.Circ Res. 2015 Sep 25;117(8):671-83. doi: 10.1161/CIRCRESAHA.114.305777. Epub 2015 Jul 20.
• [36] microRNA-32-5p targets KLF2 to promote gastric cancer by activating PI3K/AKT signaling pathway.Am J Transl Res. 2019 Aug 15;11(8):4895-4908. eCollection 2019.
• [37] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [38] Down-regulation of lung Kruppel-like factor in the nitrofen-induced hypoplastic lung.Eur J Pediatr Surg. 2011 Jan;21(1):38-41. doi: 10.1055/s-0030-1262800. Epub 2010 Nov 4.
• [39] Nuclear and Mitochondrial DNA Methylation Patterns Induced by Valproic Acid in Human Hepatocytes. Chem Res Toxicol. 2017 Oct 16;30(10):1847-1854. doi: 10.1021/acs.chemrestox.7b00171. Epub 2017 Sep 13.
• [40] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [41] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [42] Multiple pathways are involved in drug resistance to doxorubicin in an osteosarcoma cell line. Anticancer Drugs. 2008 Mar;19(3):257-65.
• [43] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [44] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [45] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [46] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [47] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [48] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [49] Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
• [50] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [51] Simvastatin inactivates beta1-integrin and extracellular signal-related kinase signaling and inhibits cell proliferation in head and neck squamous cell carcinoma cells. Cancer Sci. 2007 Jun;98(6):890-9.
• [52] Activation of SIRT1 by resveratrol induces KLF2 expression conferring an endothelial vasoprotective phenotype. Cardiovasc Res. 2010 Feb 1;85(3):514-9. doi: 10.1093/cvr/cvp337. Epub 2009 Oct 8.
• [53] Copper chelator ATN-224 inhibits endothelial function by multiple mechanisms. Microvasc Res. 2009 May;77(3):314-26.
• [54] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [55] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [56] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [57] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [58] Simvastatin has an anti-inflammatory effect on macrophages via upregulation of an atheroprotective transcription factor, Kruppel-like factor 2. Cardiovasc Res. 2008 Apr 1;78(1):175-84.
• [59] In utero Bisphenol A Exposure Is Linked with Sex Specific Changes in the Transcriptome and Methylome of Human Amniocytes. J Clin Endocrinol Metab. 2020 Feb 1;105(2):453-67. doi: 10.1210/clinem/dgz037.
• [60] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [61] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [62] Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
• [63] ERK5/HDAC5-mediated, resveratrol-, and pterostilbene-induced expression of MnSOD in human endothelial cells. Mol Nutr Food Res. 2016 Feb;60(2):266-77. doi: 10.1002/mnfr.201500466. Epub 2015 Oct 23.