Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNE20WU)

DOT Name	Cobalamin binding intrinsic factor (CBLIF)
Synonyms	Gastric intrinsic factor; Intrinsic factor; IF; INF
Gene Name	CBLIF
Related Disease	Non-insulin dependent diabetes ( ) Systemic lupus erythematosus ( ) Type-1/2 diabetes ( ) 46,XY sex reversal 2 ( ) Adult respiratory distress syndrome ( ) Alzheimer disease ( ) Bipolar disorder ( ) Bladder cancer ( ) Brucellosis ( ) Cardiac failure ( ) Charcot-Marie-Tooth disease type 3 ( ) Congestive heart failure ( ) Depression ( ) Gastritis ( ) Hepatitis B virus infection ( ) Hereditary intrinsic factor deficiency ( ) Imerslund-Grasbeck syndrome ( ) Immunodeficiency ( ) Influenza ( ) Lung cancer ( ) Lung carcinoma ( ) Lupus ( ) Major depressive disorder ( ) Malabsorption syndrome ( ) Megaloblastic anemia ( ) Multiple sclerosis ( ) Neoplasm ( ) Osteoarthritis ( ) Parkinson disease ( ) Prostate cancer ( ) Prostate carcinoma ( ) Psoriasis ( ) Schizophrenia ( ) Tuberculosis ( ) Type-1 diabetes ( ) Urinary bladder cancer ( ) Urinary bladder neoplasm ( ) Panic disorder ( ) Pulmonary fibrosis ( ) Rheumatoid arthritis ( ) Arthritis ( ) Asthma ( ) Coronary heart disease ( ) Inflammatory bowel disease ( ) Melanoma ( ) Nervous system inflammation ( ) Neuroblastoma ( ) Pernicious anemia ( ) Vitamin B12 deficiency ( )
UniProt ID	IF_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2PMV; 3KQ4
Pfam ID	PF01122
Sequence	MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIA MNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENW APSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLAL TCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPS KKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPS NPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFE TTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
Function	Promotes absorption of the essential vitamin cobalamin (Cbl) in the ileum. After interaction with CUBN, the CBLIF-cobalamin complex is internalized via receptor-mediated endocytosis.
Tissue Specificity	Gastric mucosa.
KEGG Pathway	Vitamin digestion and absorption (hsa04977 ) Cobalamin transport and metabolism (hsa04980 )
Reactome Pathway	Defective AMN causes MGA1 (R-HSA-3359462 ) Defective CUBN causes MGA1 (R-HSA-3359463 ) Uptake of dietary cobalamins into enterocytes (R-HSA-9758881 ) Defective CBLIF causes IFD (R-HSA-3359457 )

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Altered Expression	[1]
Systemic lupus erythematosus	DISI1SZ7	Definitive	Altered Expression	[2]
Type-1/2 diabetes	DISIUHAP	Definitive	Biomarker	[1]
46,XY sex reversal 2	DIS0USUN	Strong	Altered Expression	[3]
Adult respiratory distress syndrome	DISIJV47	Strong	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[5]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[6]
Bladder cancer	DISUHNM0	Strong	Biomarker	[7]
Brucellosis	DISEAYGH	Strong	Altered Expression	[8]
Cardiac failure	DISDC067	Strong	Biomarker	[9]
Charcot-Marie-Tooth disease type 3	DIS6DQK1	Strong	Altered Expression	[3]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[9]
Depression	DIS3XJ69	Strong	Biomarker	[10]
Gastritis	DIS8G07K	Strong	Altered Expression	[11]
Hepatitis B virus infection	DISLQ2XY	Strong	Altered Expression	[12]
Hereditary intrinsic factor deficiency	DISCZQBU	Strong	Autosomal recessive	[13]
Imerslund-Grasbeck syndrome	DISQ84S1	Strong	Altered Expression	[14]
Immunodeficiency	DIS093I0	Strong	Genetic Variation	[15]
Influenza	DIS3PNU3	Strong	Genetic Variation	[16]
Lung cancer	DISCM4YA	Strong	Altered Expression	[17]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[17]
Lupus	DISOKJWA	Strong	Altered Expression	[18]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[19]
Malabsorption syndrome	DISGMUVS	Strong	Biomarker	[20]
Megaloblastic anemia	DISVIZPC	Strong	Biomarker	[21]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[22]
Neoplasm	DISZKGEW	Strong	Biomarker	[23]
Osteoarthritis	DIS05URM	Strong	Biomarker	[24]
Parkinson disease	DISQVHKL	Strong	Biomarker	[2]
Prostate cancer	DISF190Y	Strong	Altered Expression	[25]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[25]
Psoriasis	DIS59VMN	Strong	Altered Expression	[26]
Schizophrenia	DISSRV2N	Strong	Biomarker	[27]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[28]
Type-1 diabetes	DIS7HLUB	Strong	Altered Expression	[1]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[7]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[7]
Panic disorder	DISD3VNY	moderate	Biomarker	[29]
Pulmonary fibrosis	DISQKVLA	moderate	Altered Expression	[30]
Rheumatoid arthritis	DISTSB4J	moderate	Altered Expression	[31]
Arthritis	DIST1YEL	Limited	Biomarker	[32]
Asthma	DISW9QNS	Limited	Altered Expression	[33]
Coronary heart disease	DIS5OIP1	Limited	Altered Expression	[34]
Inflammatory bowel disease	DISGN23E	Limited	Biomarker	[35]
Melanoma	DIS1RRCY	Limited	Biomarker	[36]
Nervous system inflammation	DISB3X5A	Limited	Biomarker	[2]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[37]
Pernicious anemia	DISWV404	Limited	Biomarker	[38]
Vitamin B12 deficiency	DIS91UJ1	Limited	Biomarker	[38]
------------------------------------------------------------------------------------


⏷ Show the Full List of 49 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Ranitidine	DM0GUSX	Approved	Cobalamin binding intrinsic factor (CBLIF) increases the Vitamin B12 deficiency ADR of Ranitidine.	[41]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin affects the expression of Cobalamin binding intrinsic factor (CBLIF).	[39]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Cobalamin binding intrinsic factor (CBLIF).	[40]
------------------------------------------------------------------------------------

References

1	Levels of cytokines and GADA in type I and II diabetic patients.Prim Care Diabetes. 2020 Feb;14(1):61-67. doi: 10.1016/j.pcd.2019.03.008. Epub 2019 Apr 20.
2	Autophagy: a potential key contributor to the therapeutic action of mesenchymal stem cells.Autophagy. 2020 Jan;16(1):28-37. doi: 10.1080/15548627.2019.1630223. Epub 2019 Jun 18.
3	Preventive Effect of Cardiotrophin-1 Administration before DSS-Induced Ulcerative Colitis in Mice.J Clin Med. 2019 Dec 1;8(12):2086. doi: 10.3390/jcm8122086.
4	RAB26-dependent autophagy protects adherens junctional integrity in acute lung injury.Autophagy. 2018;14(10):1677-1692. doi: 10.1080/15548627.2018.1476811. Epub 2018 Jul 26.
5	Suppression of MIF-induced neuronal apoptosis may underlie the therapeutic effects of effective components of Fufang Danshen in the treatment of Alzheimer's disease.Acta Pharmacol Sin. 2018 Sep;39(9):1421-1438. doi: 10.1038/aps.2017.210. Epub 2018 May 17.
6	Enrichment pathway analysis. The inflammatory genetic background in Bipolar Disorder.J Affect Disord. 2015 Jul 1;179:88-94. doi: 10.1016/j.jad.2015.03.032. Epub 2015 Mar 26.
7	Effects of tumor necrosis factor-alpha and interferon-gamma on expressions of matrix metalloproteinase-2 and -9 in human bladder cancer cells.Cancer Lett. 2000 Oct 31;159(2):127-34. doi: 10.1016/s0304-3835(00)00522-x.
8	A potential marker in brucellosis, long non coding RNA IFNG-AS1.Mol Biol Rep. 2019 Dec;46(6):6495-6500. doi: 10.1007/s11033-019-05095-w. Epub 2019 Oct 8.
9	Population Pharmacokinetics and Pharmacodynamics of Apixaban Linking Its Plasma Concentration to Intrinsic Activated Coagulation Factor X Activity in Japanese Patients with Atrial Fibrillation.AAPS J. 2019 Jun 24;21(5):80. doi: 10.1208/s12248-019-0353-7.
10	Biological mechanisms of depression following treatment with interferon for chronic hepatitis C: A critical systematic review.J Affect Disord. 2017 Feb;209:235-245. doi: 10.1016/j.jad.2016.11.039. Epub 2016 Nov 27.
11	T-bet(+) Cells Polarization in Patients Infected with Helicobacter pylori Increase the Risk of Peptic Ulcer Development.Arch Med Res. 2019 Apr;50(3):113-121. doi: 10.1016/j.arcmed.2019.07.005. Epub 2019 Aug 7.
12	Different viral kinetics between hepatitis C virus genotype 1 and 2 as on-treatment predictors of response to a 24-week course of high-dose interferon-alpha plus ribavirin combination therapy.Transl Res. 2006 Sep;148(3):120-7. doi: 10.1016/j.trsl.2006.04.006.
13	Identification of a 4-base deletion in the gene in inherited intrinsic factor deficiency. Blood. 2004 Feb 15;103(4):1515-7. doi: 10.1182/blood-2003-07-2239. Epub 2003 Oct 23.
14	An exon 53 frameshift mutation in CUBN abrogates cubam function and causes Imerslund-Grsbeck syndrome in dogs.Mol Genet Metab. 2013 Aug;109(4):390-6. doi: 10.1016/j.ymgme.2013.05.006. Epub 2013 May 22.
15	Plasma concentrations of transforming growth factor beta 1 in non-progressive HIV-1 infection correlates with markers of disease progression.Cytokine. 2016 May;81:109-16. doi: 10.1016/j.cyto.2016.02.009. Epub 2016 Mar 14.
16	An HRP-labeled lateral flow immunoassay for rapid simultaneous detection and differentiation of influenza A and B viruses.J Med Virol. 2019 Mar;91(3):503-507. doi: 10.1002/jmv.25322. Epub 2018 Oct 31.
17	ADA activity is decreased in lymphocytes from patients with advanced stage of lung cancer.Med Oncol. 2019 Aug 2;36(9):78. doi: 10.1007/s12032-019-1301-1.
18	Effects of Arsenic Trioxide on INF-gamma Gene Expression in MRL/lpr Mice and Human Lupus. Biol Trace Elem Res. 2018 Aug;184(2):391-397. doi: 10.1007/s12011-017-1206-9. Epub 2017 Nov 20.
19	Phospholipase A2 and cyclooxygenase 2 genes influence the risk of interferon-alpha-induced depression by regulating polyunsaturated fatty acids levels.Biol Psychiatry. 2010 Mar 15;67(6):550-7. doi: 10.1016/j.biopsych.2009.11.005. Epub 2009 Dec 24.
20	Cubilin P1297L mutation associated with hereditary megaloblastic anemia 1 causes impaired recognition of intrinsic factor-vitamin B(12) by cubilin. Blood. 2000 Jul 15;96(2):405-9.
21	Steroid-responsive functional B12 deficiency in association with transcobalamin II polymorphism 776C --> G.Eur J Haematol. 2006 Jan;76(1):75-8. doi: 10.1111/j.1600-0609.2005.00563.x.
22	Elastic net-based prediction of IFN- treatment response of patients with multiple sclerosis using time series microarray gene expression profiles.Sci Rep. 2019 Feb 12;9(1):1822. doi: 10.1038/s41598-018-38441-2.
23	Subcutaneous inoculation position affects the immune environment in CT26 carcinomas.Biochem Biophys Res Commun. 2019 Apr 30;512(2):244-249. doi: 10.1016/j.bbrc.2019.03.042. Epub 2019 Mar 14.
24	Bioactive Turmerosaccharides from Curcuma longa Extract (NR-INF-02): Potential Ameliorating Effect on Osteoarthritis Pain.Pharmacogn Mag. 2017 Oct;13(Suppl 3):S623-S627. doi: 10.4103/pm.pm_465_16. Epub 2017 Jul 18.
25	The migration and invasion of human prostate cancer cell lines involves CD151 expression.Oncol Rep. 2010 Dec;24(6):1593-7. doi: 10.3892/or_00001022.
26	RETRACTED: NFKB1 mediates Th1/Th17 activation in the pathogenesis of psoriasis.Cell Immunol. 2018 Sep;331:16-21. doi: 10.1016/j.cellimm.2018.04.016. Epub 2018 May 2.
27	Exome sequencing supports a de novo mutational paradigm for schizophrenia.Nat Genet. 2011 Aug 7;43(9):864-8. doi: 10.1038/ng.902.
28	Cellular immune response in MDR-TB patients to different protein expression of MDR and susceptible Mycobacterium tuberculosis: Rv0147, a novel MDR-TB biomarker.Immunol Res. 2018 Feb;66(1):59-66. doi: 10.1007/s12026-017-8971-6.
29	Cytokine alterations in panic disorder: A systematic review.J Affect Disord. 2018 Mar 1;228:91-96. doi: 10.1016/j.jad.2017.11.094. Epub 2017 Dec 7.
30	Valsartan attenuates bleomycin-induced pulmonary fibrosis by inhibition of NF-B expression and regulation of Th1/Th2 cytokines.Immunopharmacol Immunotoxicol. 2018 Jun;40(3):225-231. doi: 10.1080/08923973.2018.1431924. Epub 2018 Feb 15.
31	Systemic Resolvin E1 (RvE1) Treatment Does Not Ameliorate the Severity of Collagen-Induced Arthritis (CIA) in Mice: A Randomized, Prospective, and Controlled Proof of Concept Study.Mediators Inflamm. 2019 Oct 31;2019:5689465. doi: 10.1155/2019/5689465. eCollection 2019.
32	Hepatitis C virus-related arthritis: characteristics and response to therapy with interferon alpha.Clin Exp Rheumatol. 2000 Sep-Oct;18(5):579-84.
33	Effect of bacterial endotoxin LPS on expression of INF-gamma and IL-5 in T-lymphocytes from asthmatics.Clin Immunol. 2007 Nov;125(2):194-204. doi: 10.1016/j.clim.2007.07.012. Epub 2007 Sep 19.
34	TLR3 and TLR4 as potential clinically biomarkers of cardiovascular risk in coronary artery disease (CAD) patients.Heart Vessels. 2014 Sep;29(5):690-8. doi: 10.1007/s00380-013-0421-3. Epub 2013 Oct 22.
35	Cytokine production profile in intestinal mucosa of paediatric inflammatory bowel disease.PLoS One. 2017 Aug 10;12(8):e0182313. doi: 10.1371/journal.pone.0182313. eCollection 2017.
36	Type 1 diabetes mellitus caused by treatment with low-dose interferon- in a melanoma patient.Melanoma Res. 2017 Oct;27(5):516-518. doi: 10.1097/CMR.0000000000000381.
37	Low CD4?CD25?CD127?regulatory T cell- and high INF- levels are associated with improved survival of neuroblastoma patients treated with long-term infusion of ch14.18/CHO combined with interleukin-2.Oncoimmunology. 2019 Sep 8;8(12):1661194. doi: 10.1080/2162402X.2019.1661194. eCollection 2019.
38	High frequency of anti-parietal cell antibody (APCA) and intrinsic factor blocking antibody (IFBA) in individuals with severe vitamin B12 deficiency - an observational study in primary care patients.Clin Chem Lab Med. 2020 Feb 25;58(3):424-429. doi: 10.1515/cclm-2019-0749.
39	Molecular characterization of a toxicological tipping point during human stem cell differentiation. Reprod Toxicol. 2020 Jan;91:1-13. doi: 10.1016/j.reprotox.2019.10.001. Epub 2019 Oct 7.
40	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
41	ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.