Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRDWUO0)

• DOT Name: Actin, gamma-enteric smooth muscle (ACTG2)
• Synonyms: EC 3.6.4.-; Alpha-actin-3; Gamma-2-actin; Smooth muscle gamma-actin
• Gene Name: ACTG2
• Related Disease:
  Adult glioblastoma
  Prostate carcinoma
  Adenocarcinoma
  Advanced cancer
  Alzheimer disease
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Cerebrovascular disease
  Chronic intestinal pseudoobstruction
  Clear cell renal carcinoma
  Colon cancer
  Colonic neoplasm
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Glioblastoma multiforme
  Glioma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Insomnia
  Malaria
  Megacystis-microcolon-intestinal hypoperistalsis syndrome
  Metastatic malignant neoplasm
  Multiple sclerosis
  Myocardial infarction
  Neoplasm
  Osteosarcoma
  Ovarian cancer
  Ovarian neoplasm
  Parkinson disease
  Pertussis
  Prostate cancer
  Psychotic disorder
  Renal cell carcinoma
  Rheumatoid arthritis
  Schizophrenia
  Trichohepatoenteric syndrome
  Visceral myopathy 1
  Type-1 diabetes
  Familial visceral myopathy
  Obsolete megacystis-microcolon-intestinal hypoperistalsis syndrome
  Aplasia cutis congenita
  Asthma
  Chronic obstructive pulmonary disease
  Corpus callosum, agenesis of
  Lateral meningocele syndrome
  Limb-mammary syndrome
  Liver cancer
  Mental disorder
  Non-insulin dependent diabetes
• UniProt ID: ACTH_HUMAN
• PDB ID: 6JAT
• EC Number: 3.6.4.-
• Pfam ID: PF00022
• Sequence:
  MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM
  TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD
  LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKS
  YELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVL
  SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
  PEYDEAGPSIVHRKCF
• Function: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
• Tissue Specificity: In the intestine, abundantly expressed in smooth muscle cells of muscularis mucosa and muscularis propria. Also detected in intestinal vascular smooth muscle cells.
• KEGG Pathway:
  Vascular smooth muscle contraction (hsa04270)
  Motor proteins (hsa04814)
  Cytoskeleton in muscle cells (hsa04820)
• Reactome Pathway: Smooth Muscle Contraction (R-HSA-445355)

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Definitive	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Definitive	Biomarker	[2]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[5]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[6]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[6]
Cerebrovascular disease	DISAB237	Strong	Genetic Variation	[7]
Chronic intestinal pseudoobstruction	DISR68AN	Strong	Genetic Variation	[8]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[3]
Colon cancer	DISVC52G	Strong	Biomarker	[9]
Colonic neoplasm	DISSZ04P	Strong	Biomarker	[9]
Epithelial ovarian cancer	DIS56MH2	Strong	Genetic Variation	[10]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Genetic Variation	[11]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[1]
Glioma	DIS5RPEH	Strong	Genetic Variation	[12]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[14]
Insomnia	DIS0AFR7	Strong	Biomarker	[15]
Malaria	DISQ9Y50	Strong	Biomarker	[16]
Megacystis-microcolon-intestinal hypoperistalsis syndrome	DIS9KV47	Strong	Biomarker	[17]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[14]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[18]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[19]
Neoplasm	DISZKGEW	Strong	Altered Expression	[20]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[5]
Ovarian cancer	DISZJHAP	Strong	Genetic Variation	[10]
Ovarian neoplasm	DISEAFTY	Strong	Genetic Variation	[10]
Parkinson disease	DISQVHKL	Strong	Biomarker	[21]
Pertussis	DISQZUE7	Strong	Biomarker	[22]
Prostate cancer	DISF190Y	Strong	Biomarker	[2]
Psychotic disorder	DIS4UQOT	Strong	Biomarker	[23]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[3]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[24]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[25]
Trichohepatoenteric syndrome	DISL3ODF	Strong	Genetic Variation	[26]
Visceral myopathy 1	DIS5038N	Strong	Autosomal dominant	[27]
Type-1 diabetes	DIS7HLUB	moderate	Genetic Variation	[28]
Familial visceral myopathy	DISGJL4K	Supportive	Autosomal dominant	[29]
Obsolete megacystis-microcolon-intestinal hypoperistalsis syndrome	DISP6WWH	Supportive	Autosomal dominant	[30]
Aplasia cutis congenita	DISMDAYM	Limited	Biomarker	[31]
Asthma	DISW9QNS	Limited	Biomarker	[32]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Genetic Variation	[33]
Corpus callosum, agenesis of	DISO9P40	Limited	Biomarker	[31]
Lateral meningocele syndrome	DISG74RP	Limited	Biomarker	[34]
Limb-mammary syndrome	DIS7H4FP	Limited	Biomarker	[34]
Liver cancer	DISDE4BI	Limited	Biomarker	[35]
Mental disorder	DIS3J5R8	Limited	Biomarker	[23]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[36]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Topotecan	DMP6G8T	Approved	Actin, gamma-enteric smooth muscle (ACTG2) affects the response to substance of Topotecan.	[56]
Mitoxantrone	DMM39BF	Approved	Actin, gamma-enteric smooth muscle (ACTG2) affects the response to substance of Mitoxantrone.	[56]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[37]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[38]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[39]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[40]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[41]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[42]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[39]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[43]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[43]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[44]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[45]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[46]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[47]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[48]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[49]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[50]
Cocaine	DMSOX7I	Approved	Cocaine decreases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[51]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[52]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[54]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Actin, gamma-enteric smooth muscle (ACTG2).	[55]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Actin, gamma-enteric smooth muscle (ACTG2).	[53]

References

• [1] Rindopepimut with temozolomide for patients with newly diagnosed, EGFRvIII-expressing glioblastoma (ACT IV): a randomised, double-blind, international phase 3 trial.Lancet Oncol. 2017 Oct;18(10):1373-1385. doi: 10.1016/S1470-2045(17)30517-X. Epub 2017 Aug 23.
• [2] Early Response Monitoring Following Radiation Therapy by Using [(18)F]FDG and [(11)C]Acetate PET in Prostate Cancer Xenograft Model with Metabolomics Corroboration.Molecules. 2017 Nov 10;22(11):1946. doi: 10.3390/molecules22111946.
• [3] Dual-Tracer PET/CT Differentiates 2 Types of Primary Cancers and Metastases in a Patient With Crossed Fused Renal Ectopia.Clin Nucl Med. 2019 Feb;44(2):157-158. doi: 10.1097/RLU.0000000000002390.
• [4] Inflammatory markers in Alzheimer's disease and mild cognitive impairment: a meta-analysis and systematic review of 170 studies.J Neurol Neurosurg Psychiatry. 2019 May;90(5):590-598. doi: 10.1136/jnnp-2018-319148. Epub 2019 Jan 10.
• [5] Functional characterisation of osteosarcoma cell lines and identification of mRNAs and miRNAs associated with aggressive cancer phenotypes.Br J Cancer. 2013 Oct 15;109(8):2228-36. doi: 10.1038/bjc.2013.549. Epub 2013 Sep 24.
• [6] Association of vitamin D receptor gene polymorphisms with breast cancer risk in an Egyptian population.Tumour Biol. 2017 Oct;39(10):1010428317727738. doi: 10.1177/1010428317727738.
• [7] alpha-1-Antichymotrypsin gene A1252G variant (ACT Isehara-1) is associated with a lacunar type of ischemic cerebrovascular disease.J Hum Genet. 2001;46(1):45-7. doi: 10.1007/s100380170125.
• [8] Variants in ACTG2 underlie a substantial number of Australasian patients with primary chronic intestinal pseudo-obstruction.Neurogastroenterol Motil. 2018 Sep;30(9):e13371. doi: 10.1111/nmo.13371. Epub 2018 May 21.
• [9] Global gene expression analysis of rat colon cancers induced by a food-borne carcinogen, 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine.Carcinogenesis. 2004 Aug;25(8):1495-505. doi: 10.1093/carcin/bgh155. Epub 2004 Apr 1.
• [10] Breast and ovarian cancer referrals to the ACT Genetic Service: are we meeting guidelines?.Intern Med J. 2017 Mar;47(3):311-317. doi: 10.1111/imj.13357.
• [11] Association between the genetic variations within TBX21 gene promoter and the clinicopathological characteristics of esophageal squamous cell carcinoma in a high-risk Chinese population.Tumour Biol. 2015 May;36(5):3985-93. doi: 10.1007/s13277-015-3042-x. Epub 2015 Jan 11.
• [12] Possible association between polymorphisms of human vascular endothelial growth factor A gene and susceptibility to glioma in a Chinese population.Int J Cancer. 2011 Jan 1;128(1):166-75. doi: 10.1002/ijc.25306.
• [13] Ionizing radiation and TNF-alpha and stimulated expression of alpha1-antichymotrypsin gene in human squamous carcinoma cells.Acta Oncol. 1998;37(5):475-8. doi: 10.1080/028418698430430.
• [14] Identification of ACTG2 functions as a promoter gene in hepatocellular carcinoma cells migration and tumor metastasis.Biochem Biophys Res Commun. 2017 Sep 16;491(2):537-544. doi: 10.1016/j.bbrc.2017.04.007. Epub 2017 Apr 4.
• [15] Clinical pharmacology of the dual orexin receptor antagonist ACT-541468 in elderly subjects: Exploration of pharmacokinetics, pharmacodynamics and tolerability following single-dose morning and repeated-dose evening administration.J Psychopharmacol. 2020 Mar;34(3):326-335. doi: 10.1177/0269881119882854. Epub 2019 Oct 23.
• [16] Mass drug administration can be a valuable addition to the malaria elimination toolbox.Malar J. 2019 Aug 22;18(1):281. doi: 10.1186/s12936-019-2906-8.
• [17] Loss-of-Function Variants in MYLK Cause Recessive Megacystis Microcolon Intestinal Hypoperistalsis Syndrome. Am J Hum Genet. 2017 Jul 6;101(1):123-129. doi: 10.1016/j.ajhg.2017.05.011. Epub 2017 Jun 8.
• [18] Using mixed methods case-series evaluation in the development of a guided self-management hybrid CBT and ACT intervention for multiple sclerosis pain.Disabil Rehabil. 2017 Sep;39(18):1785-1798. doi: 10.1080/09638288.2016.1209580. Epub 2016 Aug 24.
• [19] Effects of l-arginine supplementation associated with continuous or interval aerobic training on chronic heart failure rats.Metabolism. 2017 Nov;76:1-10. doi: 10.1016/j.metabol.2017.06.009. Epub 2017 Jul 5.
• [20] Bispecific Antibodies Enable Synthetic Agonistic Receptor-Transduced T Cells for Tumor Immunotherapy.Clin Cancer Res. 2019 Oct 1;25(19):5890-5900. doi: 10.1158/1078-0432.CCR-18-3927. Epub 2019 Jul 8.
• [21] Genetic study of apolipoprotein E gene, alpha-1 antichymotrypsin gene in sporadic Parkinson disease.Am J Med Genet. 2002 May 8;114(4):446-9. doi: 10.1002/ajmg.10249.
• [22] Membrane Permeabilization by Pore-Forming RTX Toxins: What Kind of Lesions Do These Toxins Form?.Toxins (Basel). 2019 Jun 18;11(6):354. doi: 10.3390/toxins11060354.
• [23] Outcomes of clients in need of intensive team care in Flexible Assertive Community Treatment in Sweden.Nord J Psychiatry. 2018 Apr;72(3):226-231. doi: 10.1080/08039488.2018.1430168. Epub 2018 Jan 26.
• [24] Efficacy of tocilizumab monotherapy after response to combined tocilizumab and methotrexate in patients with rheumatoid arthritis: the randomised JUST-ACT study.Clin Exp Rheumatol. 2019 May-Jun;37(3):437-444. Epub 2018 Sep 17.
• [25] Association of CCL11 promoter polymorphisms with schizophrenia in a Korean population.Gene. 2018 May 20;656:80-85. doi: 10.1016/j.gene.2018.02.053. Epub 2018 Feb 22.
• [26] Compound heterozygous variants in MYH11 underlie autosomal recessive megacystis-microcolon-intestinal hypoperistalsis syndrome in a Chinese family.J Hum Genet. 2019 Nov;64(11):1067-1073. doi: 10.1038/s10038-019-0651-z. Epub 2019 Aug 19.
• [27] Familial visceral myopathy diagnosed by exome sequencing of a patient with chronic intestinal pseudo-obstruction. Endoscopy. 2014 Jun;46(6):533-7. doi: 10.1055/s-0034-1365142. Epub 2014 Apr 28.
• [28] No abnormalities of reg1 alpha and reg1 beta gene associated with diabetes mellitus.Diabetes Res Clin Pract. 2002 Feb;55(2):105-11. doi: 10.1016/s0168-8227(01)00321-7.
• [29] Segregation of a missense variant in enteric smooth muscle actin -2 with autosomal dominant familial visceral myopathy. Gastroenterology. 2012 Dec;143(6):1482-1491.e3. doi: 10.1053/j.gastro.2012.08.045. Epub 2012 Sep 6.
• [30] Heterozygous de novo and inherited mutations in the smooth muscle actin (ACTG2) gene underlie megacystis-microcolon-intestinal hypoperistalsis syndrome. PLoS Genet. 2014 Mar 27;10(3):e1004258. doi: 10.1371/journal.pgen.1004258. eCollection 2014 Mar.
• [31] Adrenocortical carcinoma -- improving patient care by establishing new structures.Exp Clin Endocrinol Diabetes. 2006 Feb;114(2):45-51. doi: 10.1055/s-2006-923808.
• [32] A Pragmatic Trial of Symptom-Based Inhaled Corticosteroid Use in African-American Children with Mild Asthma.J Allergy Clin Immunol Pract. 2020 Jan;8(1):176-185.e2. doi: 10.1016/j.jaip.2019.06.030. Epub 2019 Jul 30.
• [33] COPD patients prescribed inhaled corticosteroid in general practice: Based on disease characteristics according to guidelines?.Chron Respir Dis. 2019 Jan-Dec;16:1479973119867949. doi: 10.1177/1479973119867949.
• [34] Expression of subtype-specific group 1 leiomyosarcoma markers in a wide variety of sarcomas by gene expression analysis and immunohistochemistry.Am J Surg Pathol. 2011 Apr;35(4):583-9. doi: 10.1097/PAS.0b013e318211abd6.
• [35] Alpha1-ACT Functions as a Tumour Suppressor in Hepatocellular Carcinoma by Inhibiting the PI3K/AKT/mTOR Signalling Pathway via Activation of PTEN.Cell Physiol Biochem. 2017;41(6):2289-2306. doi: 10.1159/000475648. Epub 2017 Apr 26.
• [36] Decreased tolbutamide-stimulated insulin secretion in healthy subjects with sequence variants in the high-affinity sulfonylurea receptor gene.Diabetes. 1998 Apr;47(4):598-605. doi: 10.2337/diabetes.47.4.598.
• [37] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [38] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [39] Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
• [40] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [41] Bisphenol A effects on gene expression in adipocytes from children: association with metabolic disorders. J Mol Endocrinol. 2015 Jun;54(3):289-303.
• [42] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [43] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [44] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [45] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [46] Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
• [47] Cellular response to 5-fluorouracil (5-FU) in 5-FU-resistant colon cancer cell lines during treatment and recovery. Mol Cancer. 2006 May 18;5:20. doi: 10.1186/1476-4598-5-20.
• [48] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [49] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [50] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [51] Gene expression profiling reveals distinct cocaine-responsive genes in human fetal CNS cell types. J Addict Med. 2009 Dec;3(4):218-26. doi: 10.1097/ADM.0b013e318199d863.
• [52] A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
• [53] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [54] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [55] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [56] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.