General Information of Drug Off-Target (DOT) (ID: OTRKCCDS)

DOT Name Mas-related G-protein coupled receptor member X3 (MRGPRX3)
Synonyms Sensory neuron-specific G-protein coupled receptor 1/2
Gene Name MRGPRX3
Related Disease
Acute myelogenous leukaemia ( )
Hyperglycemia ( )
Uveal Melanoma ( )
Advanced cancer ( )
Analgesia ( )
Cardiac failure ( )
Cardiovascular disease ( )
Clear cell renal carcinoma ( )
Colorectal carcinoma ( )
Congestive heart failure ( )
Cystic fibrosis ( )
Depression ( )
Hereditary hemochromatosis ( )
Kaposi sarcoma ( )
Melanoma ( )
Metabolic disorder ( )
Multiple sclerosis ( )
Myocardial infarction ( )
Nephrogenic diabetes insipidus ( )
Non-insulin dependent diabetes ( )
Non-small-cell lung cancer ( )
Obesity ( )
Osteoarthritis ( )
Pancreatic neuroendocrine tumor ( )
Prostate cancer ( )
Prostate carcinoma ( )
Schizophrenia ( )
Thyroid gland carcinoma ( )
Thyroid gland papillary carcinoma ( )
Thyroid tumor ( )
Triple negative breast cancer ( )
Type-1/2 diabetes ( )
Autoimmune disease ( )
High blood pressure ( )
leukaemia ( )
Leukemia ( )
Small lymphocytic lymphoma ( )
Squamous cell carcinoma ( )
Parkinson disease ( )
Skin cancer ( )
Adult glioblastoma ( )
Alzheimer disease ( )
Asthma ( )
Breast cancer ( )
Breast carcinoma ( )
Carcinoma ( )
Glioblastoma multiforme ( )
Inflammatory bowel disease ( )
Osteoporosis ( )
Pancreatic cancer ( )
UniProt ID
MRGX3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00001
Sequence
MDSTIPVLGTELTPINGREETPCYKQTLSFTGLTCIVSLVALTGNAVVLWLLGCRMRRNA
VSIYILNLVAADFLFLSGHIICSPLRLINIRHPISKILSPVMTFPYFIGLSMLSAISTER
CLSILWPIWYHCRRPRYLSSVMCVLLWALSLLRSILEWMFCDFLFSGANSVWCETSDFIT
IAWLVFLCVVLCGSSLVLLVRILCGSRKMPLTRLYVTILLTVLVFLLCGLPFGIQWALFS
RIHLDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDTPE
VDEGGGWLPQETLELSGSRLEQ
Function
Orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Potently activated by enkephalins.
Tissue Specificity Uniquely localized in a subset of small dorsal root and trigeminal sensory neurons.

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute myelogenous leukaemia DISCSPTN Definitive Biomarker [1]
Hyperglycemia DIS0BZB5 Definitive Genetic Variation [2]
Uveal Melanoma DISA7ZGL Definitive Genetic Variation [3]
Advanced cancer DISAT1Z9 Strong Biomarker [4]
Analgesia DISK3TVI Strong Biomarker [5]
Cardiac failure DISDC067 Strong Biomarker [6]
Cardiovascular disease DIS2IQDX Strong Biomarker [6]
Clear cell renal carcinoma DISBXRFJ Strong Biomarker [7]
Colorectal carcinoma DIS5PYL0 Strong Genetic Variation [8]
Congestive heart failure DIS32MEA Strong Biomarker [6]
Cystic fibrosis DIS2OK1Q Strong Genetic Variation [9]
Depression DIS3XJ69 Strong Biomarker [10]
Hereditary hemochromatosis DISVG5MT Strong Biomarker [11]
Kaposi sarcoma DISC1H1Z Strong Biomarker [12]
Melanoma DIS1RRCY Strong Biomarker [13]
Metabolic disorder DIS71G5H Strong Biomarker [14]
Multiple sclerosis DISB2WZI Strong Altered Expression [15]
Myocardial infarction DIS655KI Strong Altered Expression [16]
Nephrogenic diabetes insipidus DISKNSJK Strong Biomarker [17]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [18]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [19]
Obesity DIS47Y1K Strong Biomarker [20]
Osteoarthritis DIS05URM Strong Genetic Variation [21]
Pancreatic neuroendocrine tumor DISDMPU0 Strong Biomarker [22]
Prostate cancer DISF190Y Strong Biomarker [23]
Prostate carcinoma DISMJPLE Strong Biomarker [23]
Schizophrenia DISSRV2N Strong Biomarker [24]
Thyroid gland carcinoma DISMNGZ0 Strong Genetic Variation [25]
Thyroid gland papillary carcinoma DIS48YMM Strong Genetic Variation [25]
Thyroid tumor DISLVKMD Strong Genetic Variation [25]
Triple negative breast cancer DISAMG6N Strong Biomarker [26]
Type-1/2 diabetes DISIUHAP Strong Biomarker [27]
Autoimmune disease DISORMTM moderate Biomarker [28]
High blood pressure DISY2OHH moderate Biomarker [29]
leukaemia DISS7D1V moderate Altered Expression [30]
Leukemia DISNAKFL moderate Altered Expression [30]
Small lymphocytic lymphoma DIS30POX moderate Biomarker [31]
Squamous cell carcinoma DISQVIFL moderate Biomarker [32]
Parkinson disease DISQVHKL Disputed Altered Expression [33]
Skin cancer DISTM18U Disputed Altered Expression [34]
Adult glioblastoma DISVP4LU Limited Biomarker [35]
Alzheimer disease DISF8S70 Limited Biomarker [36]
Asthma DISW9QNS Limited Biomarker [37]
Breast cancer DIS7DPX1 Limited Biomarker [38]
Breast carcinoma DIS2UE88 Limited Biomarker [38]
Carcinoma DISH9F1N Limited Genetic Variation [39]
Glioblastoma multiforme DISK8246 Limited Biomarker [35]
Inflammatory bowel disease DISGN23E Limited Biomarker [40]
Osteoporosis DISF2JE0 Limited Biomarker [41]
Pancreatic cancer DISJC981 Limited Biomarker [42]
------------------------------------------------------------------------------------
⏷ Show the Full List of 50 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Quercetin DM3NC4M Approved Quercetin increases the expression of Mas-related G-protein coupled receptor member X3 (MRGPRX3). [43]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Mas-related G-protein coupled receptor member X3 (MRGPRX3). [44]
------------------------------------------------------------------------------------

References

1 Characterization of upregulated adhesion GPCRs in acute myeloid leukemia.Transl Res. 2019 Oct;212:26-35. doi: 10.1016/j.trsl.2019.05.004. Epub 2019 May 17.
2 Proinflammatory switch from Gs to Gi signaling by Glucagon-like peptide-1 receptor in murine splenic monocyte following burn injury.Inflamm Res. 2018 Feb;67(2):157-168. doi: 10.1007/s00011-017-1104-9. Epub 2017 Oct 11.
3 Atypical activation of the G protein G(q) by the oncogenic mutation Q209P.J Biol Chem. 2018 Dec 21;293(51):19586-19599. doi: 10.1074/jbc.RA118.005291. Epub 2018 Oct 23.
4 Established and In-trial GPCR Families in Clinical Trials: A Review for Target Selection.Curr Drug Targets. 2019;20(5):522-539. doi: 10.2174/1389450120666181105152439.
5 Positive Modulation of Angiotensin II Type 1 Receptor-Mediated Signaling by LVV-Hemorphin-7.Front Pharmacol. 2019 Oct 25;10:1258. doi: 10.3389/fphar.2019.01258. eCollection 2019.
6 GRK2 as a therapeutic target for heart failure.Expert Opin Ther Targets. 2018 Jan;22(1):75-83. doi: 10.1080/14728222.2018.1406925. Epub 2017 Nov 23.
7 The G-protein-coupled receptor CLR is upregulated in an autocrine loop with adrenomedullin in clear cell renal cell carcinoma and associated with poor prognosis.Clin Cancer Res. 2013 Oct 15;19(20):5740-8. doi: 10.1158/1078-0432.CCR-13-1712. Epub 2013 Aug 22.
8 Evolution and heterogeneity of non-hereditary colorectal cancer revealed by single-cell exome sequencing.Oncogene. 2017 May 18;36(20):2857-2867. doi: 10.1038/onc.2016.438. Epub 2016 Dec 12.
9 2-Adrenergic receptor agonists activate CFTR in intestinal organoids and subjects with cystic fibrosis.Eur Respir J. 2016 Sep;48(3):768-79. doi: 10.1183/13993003.01661-2015. Epub 2016 Jul 28.
10 Moonlighting characteristics of G protein-coupled receptors: focus on receptor heteromers and relevance for neurodegeneration.IUBMB Life. 2011 Jul;63(7):463-72. doi: 10.1002/iub.473.
11 An intracellular activation of Smoothened that is independent of Hedgehog stimulation in Drosophila.J Cell Sci. 2018 Jan 4;131(1):jcs211367. doi: 10.1242/jcs.211367.
12 The Kaposi's sarcoma-associated herpesvirus G protein-coupled receptor: Lessons on dysregulated angiogenesis from a viral oncogene.J Cell Biochem. 2010 May;110(1):1-9. doi: 10.1002/jcb.22524.
13 GPR56 and its related diseases.Prog Mol Biol Transl Sci. 2009;89:1-13. doi: 10.1016/S1877-1173(09)89001-7. Epub 2009 Oct 7.
14 Evaluation of novel TGR5 agonist in combination with Sitagliptin for possible treatment of type 2 diabetes.Bioorg Med Chem Lett. 2018 Jun 1;28(10):1849-1852. doi: 10.1016/j.bmcl.2018.04.011. Epub 2018 Apr 5.
15 Computer design, synthesis, and bioactivity analyses of drugs like fingolimod used in the treatment of multiple sclerosis.Bioorg Med Chem. 2017 Jan 15;25(2):483-495. doi: 10.1016/j.bmc.2016.11.015. Epub 2016 Nov 18.
16 Endothelin-1 promotes hypertrophic remodelling of cardiac myocytes by activating sustained signalling and transcription downstream of endothelin type A receptors.Cell Signal. 2017 Aug;36:240-254. doi: 10.1016/j.cellsig.2017.04.010. Epub 2017 Apr 13.
17 Signaling Modification by GPCR Heteromer and Its Implication on X-Linked Nephrogenic Diabetes Insipidus.PLoS One. 2016 Sep 20;11(9):e0163086. doi: 10.1371/journal.pone.0163086. eCollection 2016.
18 Discovery and biological evaluation of novel G protein-coupled receptor 119 agonists for type 2 diabetes.Arch Pharm (Weinheim). 2019 Apr;352(4):e1800267. doi: 10.1002/ardp.201800267. Epub 2019 Feb 10.
19 Multiple analyses of G-protein coupled receptor (GPCR) expression in the development of gefitinib-resistance in transforming non-small-cell lung cancer.PLoS One. 2012;7(10):e44368. doi: 10.1371/journal.pone.0044368. Epub 2012 Oct 29.
20 Peptide/Receptor Co-evolution Explains the Lipolytic Function of the Neuropeptide TLQP-21.Cell Rep. 2019 Sep 3;28(10):2567-2580.e6. doi: 10.1016/j.celrep.2019.07.101.
21 A functional SNP in EDG2 increases susceptibility to knee osteoarthritis in Japanese.Hum Mol Genet. 2008 Jun 15;17(12):1790-7. doi: 10.1093/hmg/ddn069. Epub 2008 Mar 6.
22 Differentiation of small bowel and pancreatic neuroendocrine tumors by gene-expression profiling.Surgery. 2012 Dec;152(6):998-1007. doi: 10.1016/j.surg.2012.08.040.
23 Activation of PSGR with -ionone suppresses prostate cancer progression by blocking androgen receptor nuclear translocation.Cancer Lett. 2019 Jul 1;453:193-205. doi: 10.1016/j.canlet.2019.03.044. Epub 2019 Mar 27.
24 Differential allosteric modulation within dopamine D(2)R - neurotensin NTS1R and D(2)R - serotonin 5-HT(2A)R receptor complexes gives bias to intracellular calcium signalling.Sci Rep. 2019 Nov 8;9(1):16312. doi: 10.1038/s41598-019-52540-8.
25 GPCR-mediated PI3K pathway mutations in pediatric and adult thyroid cancer.Oncotarget. 2019 Jun 25;10(41):4107-4124. doi: 10.18632/oncotarget.26993. eCollection 2019 Jun 25.
26 G-protein-coupled receptor GPR161 is overexpressed in breast cancer and is a promoter of cell proliferation and invasion.Proc Natl Acad Sci U S A. 2014 Mar 18;111(11):4191-6. doi: 10.1073/pnas.1320239111. Epub 2014 Mar 5.
27 Current status of G-protein coupled receptors as potential targets against type 2 diabetes mellitus.Int J Biol Macromol. 2018 Oct 15;118(Pt B):2237-2244. doi: 10.1016/j.ijbiomac.2018.07.091. Epub 2018 Jul 17.
28 Characterization, Dynamics, and Mechanism of CXCR4 Antagonists on a Constitutively Active Mutant.Cell Chem Biol. 2019 May 16;26(5):662-673.e7. doi: 10.1016/j.chembiol.2019.01.012. Epub 2019 Feb 28.
29 G-Protein-Coupled Receptors in Heart Disease.Circ Res. 2018 Aug 31;123(6):716-735. doi: 10.1161/CIRCRESAHA.118.311403.
30 Visualization of ligand-induced G(i)-protein activation in chemotaxing cells.FASEB J. 2017 Mar;31(3):910-919. doi: 10.1096/fj.201601102R. Epub 2016 Nov 23.
31 The G protein-coupled receptor CysLT1 mediates chemokine-like effects and prolongs survival in chronic lymphocytic leukemia.Leuk Lymphoma. 2012 Apr;53(4):665-73. doi: 10.3109/10428194.2011.625578.
32 Identification and characterization of a novel CXC chemokine in xenograft tumor induced by mas-overexpressing cells.Int J Cancer. 2009 Sep 15;125(6):1316-27. doi: 10.1002/ijc.24440.
33 Analysis of positive and negative allosteric modulation in metabotropic glutamate receptors 4 and 5 with a dual ligand.Sci Rep. 2017 Jul 10;7(1):4944. doi: 10.1038/s41598-017-05095-5.
34 Expression of proton-sensing G-protein-coupled receptors in selected skin tumors.Exp Dermatol. 2019 Jan;28(1):66-71. doi: 10.1111/exd.13809. Epub 2018 Dec 13.
35 YAP and MRTF-A, transcriptional co-activators of RhoA-mediated gene expression, are critical for glioblastoma tumorigenicity.Oncogene. 2018 Oct;37(41):5492-5507. doi: 10.1038/s41388-018-0301-5. Epub 2018 Jun 11.
36 Monoamines and their Derivatives on GPCRs: Potential Therapy for Alzheimer's Disease.Curr Alzheimer Res. 2019;16(10):871-894. doi: 10.2174/1570159X17666190409144558.
37 G Protein-Coupled Receptors in Asthma Therapy: Pharmacology and Drug Action.Pharmacol Rev. 2020 Jan;72(1):1-49. doi: 10.1124/pr.118.016899.
38 Human G protein-coupled receptor 30 is N-glycosylated and N-terminal domain asparagine 44 is required for receptor structure and activity.Biosci Rep. 2019 Feb 26;39(2):BSR20182436. doi: 10.1042/BSR20182436. Print 2019 Feb 28.
39 MALT1 is a critical mediator of PAR1-driven NF-B activation and metastasis in multiple tumor types.Oncogene. 2019 Dec;38(49):7384-7398. doi: 10.1038/s41388-019-0958-4. Epub 2019 Aug 16.
40 Microbiota metabolite short chain fatty acids, GPCR, and inflammatory bowel diseases.J Gastroenterol. 2017 Jan;52(1):1-8. doi: 10.1007/s00535-016-1242-9. Epub 2016 Jul 23.
41 Wnt5a/FZD4 Mediates the Mechanical Stretch-Induced Osteogenic Differentiation of Bone Mesenchymal Stem Cells.Cell Physiol Biochem. 2018;48(1):215-226. doi: 10.1159/000491721. Epub 2018 Jul 13.
42 Insulin Receptor and GPCR Crosstalk Stimulates YAP via PI3K and PKD in Pancreatic Cancer Cells.Mol Cancer Res. 2017 Jul;15(7):929-941. doi: 10.1158/1541-7786.MCR-17-0023. Epub 2017 Mar 30.
43 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
44 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.