Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSZHUHQ)

• DOT Name: Epithelial membrane protein 1 (EMP1)
• Synonyms: EMP-1; CL-20; Protein B4B; Tumor-associated membrane protein
• Gene Name: EMP1
• Related Disease:
  Asthma
  Carcinoma of esophagus
  Cerebral infarction
  Esophageal cancer
  Neoplasm of esophagus
  Adult glioblastoma
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Bacillary dysentery
  Bacteremia
  Brain neoplasm
  Breast cancer
  Breast carcinoma
  Cerebral cavernous malformation
  Classic Hodgkin lymphoma
  Gastric cancer
  Glioblastoma multiforme
  Glioma
  Gonorrhea
  Huntington disease
  Immunodeficiency
  Laryngeal carcinoma
  Lung cancer
  Major depressive disorder
  Malaria
  Malignant glioma
  Nasal polyp
  Neoplasm
  Non-small-cell lung cancer
  Pneumocystis pneumonia
  Pneumonia
  Prostate cancer
  Prostate neoplasm
  Psoriasis
  Stomach cancer
  Systemic lupus erythematosus
  Thrombocytopenia
  Toxoplasmosis
  Bacterial infection
  Metastatic malignant neoplasm
  Prostate carcinoma
  Squamous cell carcinoma
  Advanced cancer
  Congenital contractural arachnodactyly
  Cystitis
  Lung carcinoma
• UniProt ID: EMP1_HUMAN
• Pfam ID: PF00822
• Sequence:
  MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDA
  LKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHY
  ANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK
• KEGG Pathway: Focal adhesion (hsa04510)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Asthma	DISW9QNS	Definitive	Genetic Variation	[1]
Carcinoma of esophagus	DISS6G4D	Definitive	Biomarker	[2]
Cerebral infarction	DISR1WNP	Definitive	Altered Expression	[3]
Esophageal cancer	DISGB2VN	Definitive	Altered Expression	[2]
Neoplasm of esophagus	DISOLKAQ	Definitive	Altered Expression	[2]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[5]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[6]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[6]
Bacillary dysentery	DISFZHKN	Strong	Biomarker	[7]
Bacteremia	DIS6N9RZ	Strong	Biomarker	[8]
Brain neoplasm	DISY3EKS	Strong	Biomarker	[9]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[10]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[10]
Cerebral cavernous malformation	DISLKNYA	Strong	Biomarker	[11]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[12]
Gastric cancer	DISXGOUK	Strong	Biomarker	[13]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[14]
Glioma	DIS5RPEH	Strong	Biomarker	[15]
Gonorrhea	DISQ5AO6	Strong	Altered Expression	[16]
Huntington disease	DISQPLA4	Strong	Biomarker	[12]
Immunodeficiency	DIS093I0	Strong	Biomarker	[17]
Laryngeal carcinoma	DISNHCIV	Strong	Altered Expression	[18]
Lung cancer	DISCM4YA	Strong	Biomarker	[19]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[20]
Malaria	DISQ9Y50	Strong	Biomarker	[21]
Malignant glioma	DISFXKOV	Strong	Biomarker	[4]
Nasal polyp	DISLP3XE	Strong	Altered Expression	[16]
Neoplasm	DISZKGEW	Strong	Biomarker	[11]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[22]
Pneumocystis pneumonia	DISFSOM3	Strong	Biomarker	[23]
Pneumonia	DIS8EF3M	Strong	Genetic Variation	[24]
Prostate cancer	DISF190Y	Strong	Biomarker	[25]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[26]
Psoriasis	DIS59VMN	Strong	Altered Expression	[27]
Stomach cancer	DISKIJSX	Strong	Biomarker	[13]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[28]
Thrombocytopenia	DISU61YW	Strong	Genetic Variation	[29]
Toxoplasmosis	DISYP8FH	Strong	Biomarker	[30]
Bacterial infection	DIS5QJ9S	moderate	Biomarker	[31]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[25]
Prostate carcinoma	DISMJPLE	moderate	Biomarker	[25]
Squamous cell carcinoma	DISQVIFL	moderate	Altered Expression	[32]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[33]
Congenital contractural arachnodactyly	DISOM1K7	Limited	Altered Expression	[34]
Cystitis	DIS2D4B9	Limited	Genetic Variation	[35]
Lung carcinoma	DISTR26C	Limited	Biomarker	[19]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Epithelial membrane protein 1 (EMP1).	[36]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Epithelial membrane protein 1 (EMP1).	[37]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Epithelial membrane protein 1 (EMP1).	[38]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Epithelial membrane protein 1 (EMP1).	[39]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Epithelial membrane protein 1 (EMP1).	[40]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Epithelial membrane protein 1 (EMP1).	[41]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Epithelial membrane protein 1 (EMP1).	[42]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Epithelial membrane protein 1 (EMP1).	[43]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Epithelial membrane protein 1 (EMP1).	[44]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Epithelial membrane protein 1 (EMP1).	[45]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Epithelial membrane protein 1 (EMP1).	[46]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Epithelial membrane protein 1 (EMP1).	[47]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Epithelial membrane protein 1 (EMP1).	[48]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Epithelial membrane protein 1 (EMP1).	[49]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Epithelial membrane protein 1 (EMP1).	[50]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Epithelial membrane protein 1 (EMP1).	[46]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Epithelial membrane protein 1 (EMP1).	[51]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Epithelial membrane protein 1 (EMP1).	[38]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Epithelial membrane protein 1 (EMP1).	[52]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Epithelial membrane protein 1 (EMP1).	[53]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Epithelial membrane protein 1 (EMP1).	[54]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide increases the expression of Epithelial membrane protein 1 (EMP1).	[52]
Alitretinoin	DMME8LH	Approved	Alitretinoin increases the expression of Epithelial membrane protein 1 (EMP1).	[38]
Dactinomycin	DM2YGNW	Approved	Dactinomycin increases the expression of Epithelial membrane protein 1 (EMP1).	[52]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Epithelial membrane protein 1 (EMP1).	[55]
Rigosertib	DMOSTXF	Phase 3	Rigosertib increases the expression of Epithelial membrane protein 1 (EMP1).	[56]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of Epithelial membrane protein 1 (EMP1).	[57]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Epithelial membrane protein 1 (EMP1).	[59]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Epithelial membrane protein 1 (EMP1).	[61]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Epithelial membrane protein 1 (EMP1).	[62]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid increases the expression of Epithelial membrane protein 1 (EMP1).	[38]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Epithelial membrane protein 1 (EMP1).	[58]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Epithelial membrane protein 1 (EMP1).	[60]

References

• [1] Efficacies of atovaquone, pentamidine, and trimethoprim/sulfamethoxazole for the prevention of Pneumocystis jirovecii pneumonia in patients with connective tissue diseases.J Infect Chemother. 2019 May;25(5):351-354. doi: 10.1016/j.jiac.2019.01.005. Epub 2019 Jan 31.
• [2] Analysis of gene expression profile induced by EMP-1 in esophageal cancer cells using cDNA Microarray.World J Gastroenterol. 2003 Mar;9(3):392-8. doi: 10.3748/wjg.v9.i3.392.
• [3] The epithelial membrane protein 1 is a novel tight junction protein of the blood-brain barrier.J Cereb Blood Flow Metab. 2008 Jun;28(6):1249-60. doi: 10.1038/jcbfm.2008.19. Epub 2008 Apr 2.
• [4] Epithelial membrane protein 1 promotes glioblastoma progression through the PI3K/AKT/mTOR signaling pathway.Oncol Rep. 2019 Aug;42(2):605-614. doi: 10.3892/or.2019.7204. Epub 2019 Jun 19.
• [5] Evidence of recessive Alzheimer disease loci in a Caribbean Hispanic data set: genome-wide survey of runs of homozygosity.JAMA Neurol. 2013 Oct;70(10):1261-7. doi: 10.1001/jamaneurol.2013.3545.
• [6] A newly synthesized Ligustrazine stilbene derivative inhibits PDGF-BB induced vascular smooth muscle cell phenotypic switch and proliferation via delaying cell cycle progression.Eur J Pharmacol. 2017 Nov 5;814:106-113. doi: 10.1016/j.ejphar.2017.08.008. Epub 2017 Aug 12.
• [7] Clonal dissemination of a single Shigella sonnei strain among Iranian children during Fall 2012 in Tehran, I.R. Iran.Infect Genet Evol. 2015 Aug;34:260-6. doi: 10.1016/j.meegid.2015.06.024. Epub 2015 Jun 24.
• [8] Oral Fluoroquinolone or Trimethoprim-sulfamethoxazole vs. -lactams as Step-Down Therapy for Enterobacteriaceae Bacteremia: Systematic Review and Meta-analysis.Open Forum Infect Dis. 2019 Aug 14;6(10):ofz364. doi: 10.1093/ofid/ofz364. Online ahead of print.
• [9] Chromosomal mapping of Tmp (Emp1), Xmp (Emp2), and Ymp (Emp3), genes encoding membrane proteins related to Pmp22.Genomics. 1998 May 1;49(3):443-7. doi: 10.1006/geno.1998.5238.
• [10] BTG1 expression correlates with the pathogenesis and progression of breast carcinomas.Tumour Biol. 2014 Apr;35(4):3317-26. doi: 10.1007/s13277-013-1437-0. Epub 2013 Nov 24.
• [11] p53, miR-34a and EMP1-Newly Identified Targets of TFF3 Signaling in Y79 Retinoblastoma Cells.Int J Mol Sci. 2019 Aug 24;20(17):4129. doi: 10.3390/ijms20174129.
• [12] Antibiotic Prophylaxis for Melioidosis in Patients Receiving Hemodialysis in the Tropics? One Size Does Not Fit All.Am J Trop Med Hyg. 2018 Sep;99(3):597-600. doi: 10.4269/ajtmh.18-0421. Epub 2018 Jul 12.
• [13] Association of EMP1 with gastric carcinoma invasion, survival and prognosis.Int J Oncol. 2014 Sep;45(3):1091-8. doi: 10.3892/ijo.2014.2488. Epub 2014 Jun 10.
• [14] In vivo CRISPR screening in CD8 T cells with AAV-Sleeping Beauty hybrid vectors identifies membrane targets for improving immunotherapy for glioblastoma.Nat Biotechnol. 2019 Nov;37(11):1302-1313. doi: 10.1038/s41587-019-0246-4. Epub 2019 Sep 23.
• [15] EMP1 regulates cell proliferation, migration, and stemness in gliomas through PI3K-AKT signaling and CD44.J Cell Biochem. 2019 Oct;120(10):17142-17150. doi: 10.1002/jcb.28974. Epub 2019 May 20.
• [16] Down-regulation of EMP1 is associated with epithelial hyperplasia and metaplasia in nasal polyps.Histopathology. 2013 Nov;63(5):686-95. doi: 10.1111/his.12211. Epub 2013 Aug 29.
• [17] The role of CD4 cell count as discriminatory measure to guide chemoprophylaxis against Pneumocystis jirovecii pneumonia in human immunodeficiency virus-negative immunocompromised patients: A systematic review.Transpl Infect Dis. 2017 Apr;19(2). doi: 10.1111/tid.12651. Epub 2017 Feb 15.
• [18] The expression and function of epithelial membrane protein 1 in laryngeal carcinoma.Int J Oncol. 2017 Jan;50(1):141-148. doi: 10.3892/ijo.2016.3782. Epub 2016 Nov 28.
• [19] EMP1, EMP 2, and EMP3 as novel therapeutic targets in human cancer.Biochim Biophys Acta Rev Cancer. 2017 Aug;1868(1):199-211. doi: 10.1016/j.bbcan.2017.04.004. Epub 2017 Apr 10.
• [20] Gene expression and association analysis of the epithelial membrane protein 1 gene in major depressive disorder in the Japanese population.Neurosci Lett. 2011 Feb 4;489(2):126-30. doi: 10.1016/j.neulet.2010.12.001. Epub 2010 Dec 10.
• [21] Associations between IgG reactivity to Plasmodium falciparum erythrocyte membrane protein 1 (PfEMP1) antigens and Burkitt lymphoma in Ghana and Uganda case-control studies.EBioMedicine. 2019 Jan;39:358-368. doi: 10.1016/j.ebiom.2018.12.020. Epub 2018 Dec 20.
• [22] The expression of BTG1 is downregulated in NSCLC and possibly associated with tumor metastasis.Tumour Biol. 2014 Apr;35(4):2949-57. doi: 10.1007/s13277-013-1379-6. Epub 2013 Nov 22.
• [23] Anidulafungin as an alternative treatment for Pneumocystis jirovecii pneumonia in patients who cannot tolerate trimethoprim/sulfamethoxazole.Int J Antimicrob Agents. 2020 Jan;55(1):105820. doi: 10.1016/j.ijantimicag.2019.10.001. Epub 2019 Oct 14.
• [24] Infectious disease ward admission positively influences P. jiroveci pneumonia (PjP) outcome: A retrospective analysis of 116 HIV-positive and HIV-negative immunocompromised patients.PLoS One. 2017 May 15;12(5):e0176881. doi: 10.1371/journal.pone.0176881. eCollection 2017.
• [25] Epithelial membrane protein 1 promotes tumor metastasis by enhancing cell migration via copine-III and Rac1.Oncogene. 2018 Oct;37(40):5416-5434. doi: 10.1038/s41388-018-0286-0. Epub 2018 Jun 4.
• [26] Global analysis of differentially expressed genes in androgen-independent prostate cancer.Prostate Cancer Prostatic Dis. 2007;10(2):167-74. doi: 10.1038/sj.pcan.4500933. Epub 2007 Jan 2.
• [27] Levels of miR-31 and its target genes in dermal mesenchymal cells of patients with psoriasis.Int J Dermatol. 2019 Feb;58(2):198-204. doi: 10.1111/ijd.14197. Epub 2018 Sep 9.
• [28] Trimethoprim-sulfamethoxazole induced circulatory shock in a human immunodeficiency virus uninfected patient: a case report and review.BMC Pharmacol Toxicol. 2018 Nov 20;19(1):76. doi: 10.1186/s40360-018-0269-3.
• [29] Life-Threatening Thrombocytopenia Secondary to Trimethoprim/Sulfamethoxazole.Cureus. 2017 Dec 19;9(12):e1963. doi: 10.7759/cureus.1963.
• [30] Toxoplasmosis in non-cardiac solid organ transplant recipients: A case series and review of literature.Transpl Infect Dis. 2020 Feb;22(1):e13218. doi: 10.1111/tid.13218. Epub 2019 Dec 12.
• [31] Dissemination of Trimethoprim-Sulfamethoxazole Drug Resistance Genes Associated with Class 1 and Class 2 Integrons Among Gram-Negative Bacteria from HIV Patients in South India.Microb Drug Resist. 2017 Jul;23(5):602-608. doi: 10.1089/mdr.2016.0034. Epub 2016 Nov 17.
• [32] The expression of EMP1 is downregulated in oral squamous cell carcinoma and possibly associated with tumour metastasis.J Clin Pathol. 2011 Jan;64(1):25-9. doi: 10.1136/jcp.2010.082404. Epub 2010 Oct 27.
• [33] The Pivotal Roles of the Epithelial Membrane Protein Family in Cancer Invasiveness and Metastasis.Cancers (Basel). 2019 Oct 23;11(11):1620. doi: 10.3390/cancers11111620.
• [34] Suppression of trophoblast cell surface antigen 2 enhances proliferation and migration in liver fluke-associated cholangiocarcinoma.Ann Hepatol. 2016 Jan-Feb;15(1):71-81. doi: 10.5604/16652681.1184223.
• [35] Risk factors for trimethoprim-sulfamethoxazole resistance in patients with acute uncomplicated cystitis.Antimicrob Agents Chemother. 2008 Mar;52(3):846-51. doi: 10.1128/AAC.01200-07. Epub 2007 Dec 17.
• [36] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [37] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [38] Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
• [39] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [40] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [41] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [42] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [43] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [44] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [45] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [46] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [47] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [48] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [49] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [50] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [51] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [52] Genomic profiling uncovers a molecular pattern for toxicological characterization of mutagens and promutagens in vitro. Toxicol Sci. 2011 Jul;122(1):185-97.
• [53] Characterizing the genetic basis for nicotine induced cancer development: a transcriptome sequencing study. PLoS One. 2013 Jun 18;8(6):e67252.
• [54] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [55] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [56] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
• [57] PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
• [58] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [59] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [60] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [61] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [62] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.