Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWJ2OR8)

• DOT Name: Zinc finger protein castor homolog 1 (CASZ1)
• Synonyms: Castor-related protein; Putative survival-related protein; Zinc finger protein 693
• Gene Name: CASZ1
• Related Disease:
  Hepatitis B virus infection
  Neuroblastoma
  Obesity
  Acute myelogenous leukaemia
  Advanced cancer
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Atrial fibrillation
  Breast neoplasm
  Cardiac failure
  Cardiovascular disease
  Cervical cancer
  Cervical carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Congestive heart failure
  Coronary heart disease
  Dilated cardiomyopathy
  Dilated cardiomyopathy 1A
  Endometrial carcinoma
  Glioma
  Hepatocellular carcinoma
  High blood pressure
  Lung cancer
  Lung carcinoma
  Myocardial infarction
  Neoplasm
  Non-small-cell lung cancer
  Plasma cell myeloma
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Ulcerative colitis
  Varicose veins
  Ventricular septal defect
  Amyotrophic lateral sclerosis
  Familial atrial fibrillation
  Lymphoma
  Neuralgia
  Type-1/2 diabetes
  Type-1 diabetes
  Alopecia
  Chronic obstructive pulmonary disease
  Clear cell renal carcinoma
  Non-insulin dependent diabetes
  Osteoarthritis
  Stroke
• UniProt ID: CASZ1_HUMAN
• Sequence:
  MDLGTAEGTRCTDPPAGKPAMAPKRKGGLKLNAICAKLSRQVVVEKRADAGSHTEGSPSQ
  PRDQERSGPESGAARAPRSEEDKRRAVIEKWVNGEYSEEPAPTPVLGRIAREGLELPPEG
  VYMVQPQGCSDEEDHAEEPSKDGGALEEKDSDGAASKEDSGPSTRQASGEASSLRDYAAS
  TMTEFLGMFGYDDQNTRDELARKISFEKLHAGSTPEAATSSMLPTSEDTLSKRARFSKYE
  EYIRKLKAGEQLSWPAPSTKTEERVGKEVVGTLPGLRLPSSTAHLETKATILPLPSHSSV
  QMQNLVARASKYDFFIQKLKTGENLRPQNGSTYKKPSKYDLENVKYLHLFKPGEGSPDMG
  GAIAFKTGKVGRPSKYDVRGIQKPGPAKVPPTPSLAPAPLASVPSAPSAPGPGPEPPASL
  SFNTPEYLKSTFSKTDSITTGTVSTVKNGLPTDKPAVTEDVNIYQKYIARFSGSQHCGHI
  HCAYQYREHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYH
  GCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTADC
  QFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCV
  YSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGALGLPPSLLGAKDTEHEES
  SNDDLVDFSALSSKNSSLSASPTSQQSSASLAAATAATEAGPSATKPPNSKISGLLPQGL
  PGSIPLALALSNSGLPTPTPYFPILAGRGSTSLPVGTPSLLGAVSSGSAASATPDTPTLV
  ASGAGDSAPVAAASVPAPPASIMERISASKGLISPMMARLAAAALKPSATFDPGSGQQVT
  PARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPANSSLLSSLMNK
  MSQGNPGLGSLLNIKAEAEGSPAAEPSPFLGKAVKALVQEKLAEPWKVYLRRFGTKDFCD
  GQCDFLHKAHFHCVVEECGALFSTLDGAIKHANFHFRTEGGAAKGNTEAAFPASAAETKP
  PMAPSSPPVPPVTTATVSSLEGPAPSPASVPSTPTLLAWKQLASTIPQMPQIPASVPHLP
  ASPLATTSLENAKPQVKPGFLQFQENDPCLATDCKYANKFHFHCLFGNCKYVCKTSGKAE
  SHCLDHINPNNNLVNVRDQFAYYSLQCLCPNQHCEFRMRGHYHCLRTGCYFVTNITTKLP
  WHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSH
  ARKHMRRMLGKNFDRVPPSQGPPGLMDAETDECMDYTGCSPGAMSSESSTMDRSCSSTPV
  GNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLY
  EDCKDAACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLS
  CHFADCPFSGTSTHFHCLRCRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVP
  DCKYKLKCSHFHCTFPGCRHTVVGMSQMDSHKRKHEKQERGEPAAEGPAPGPPISLDGSL
  SLGAEPGSLLFLQSAAAGLGLALGDAGDPGPPDAAAPGPREGAAAAAAAAGESSQEDEEE
  ELELPEEEAEDDEDEDDDEDDDDEDDDEDDDDEDLRTDSEESLPEAAAEAAGAGARTPAL
  AALAALGAPGPAPTAASSP
• Function: Transcriptional activator. Involved in vascular assembly and morphogenesis through direct transcriptional regulation of EGFL7.
• Tissue Specificity: Expressed in heart, lung, skeletal muscle, pancreas, testis, small intestine, and stomach, but it is not detectable in the adult brain.

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatitis B virus infection	DISLQ2XY	Definitive	Biomarker	[1]
Neuroblastoma	DISVZBI4	Definitive	Altered Expression	[2]
Obesity	DIS47Y1K	Definitive	Biomarker	[3]
Acute myelogenous leukaemia	DISCSPTN	Strong	Posttranslational Modification	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Alzheimer disease	DISF8S70	Strong	Biomarker	[6]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[7]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[7]
Atrial fibrillation	DIS15W6U	Strong	Genetic Variation	[8]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[9]
Cardiac failure	DISDC067	Strong	Biomarker	[10]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[11]
Cervical cancer	DISFSHPF	Strong	Biomarker	[12]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[12]
Colon cancer	DISVC52G	Strong	Biomarker	[13]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[13]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[14]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[10]
Coronary heart disease	DIS5OIP1	Strong	Biomarker	[7]
Dilated cardiomyopathy	DISX608J	Strong	Genetic Variation	[15]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Genetic Variation	[15]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[16]
Glioma	DIS5RPEH	Strong	Genetic Variation	[17]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[18]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[19]
Lung cancer	DISCM4YA	Strong	Biomarker	[20]
Lung carcinoma	DISTR26C	Strong	Biomarker	[20]
Myocardial infarction	DIS655KI	Strong	Altered Expression	[21]
Neoplasm	DISZKGEW	Strong	Altered Expression	[2]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[22]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[23]
Prostate cancer	DISF190Y	Strong	Biomarker	[24]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[25]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[24]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[26]
Varicose veins	DISIMBN2	Strong	Genetic Variation	[27]
Ventricular septal defect	DISICO41	Strong	Genetic Variation	[15]
Amyotrophic lateral sclerosis	DISF7HVM	moderate	Biomarker	[28]
Familial atrial fibrillation	DISL4AGF	moderate	Biomarker	[8]
Lymphoma	DISN6V4S	moderate	Biomarker	[29]
Neuralgia	DISWO58J	moderate	Biomarker	[30]
Type-1/2 diabetes	DISIUHAP	moderate	Biomarker	[31]
Type-1 diabetes	DIS7HLUB	Disputed	Biomarker	[32]
Alopecia	DIS37HU4	Limited	Genetic Variation	[33]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Genetic Variation	[34]
Clear cell renal carcinoma	DISBXRFJ	Limited	Altered Expression	[2]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Altered Expression	[35]
Osteoarthritis	DIS05URM	Limited	Biomarker	[36]
Stroke	DISX6UHX	Limited	Genetic Variation	[37]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Zinc finger protein castor homolog 1 (CASZ1).	[38]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Zinc finger protein castor homolog 1 (CASZ1).	[42]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Zinc finger protein castor homolog 1 (CASZ1).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Zinc finger protein castor homolog 1 (CASZ1).	[49]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Zinc finger protein castor homolog 1 (CASZ1).	[39]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Zinc finger protein castor homolog 1 (CASZ1).	[40]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Zinc finger protein castor homolog 1 (CASZ1).	[41]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Zinc finger protein castor homolog 1 (CASZ1).	[43]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Zinc finger protein castor homolog 1 (CASZ1).	[44]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Zinc finger protein castor homolog 1 (CASZ1).	[45]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Zinc finger protein castor homolog 1 (CASZ1).	[46]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Zinc finger protein castor homolog 1 (CASZ1).	[48]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Zinc finger protein castor homolog 1 (CASZ1).	[46]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Zinc finger protein castor homolog 1 (CASZ1).	[50]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Zinc finger protein castor homolog 1 (CASZ1).	[51]

References

• [1] Investigation of the clinical significance and prospective molecular mechanisms of cystatin genes in patients with hepatitis B virusrelated hepatocellular carcinoma.Oncol Rep. 2019 Jul;42(1):189-201. doi: 10.3892/or.2019.7154. Epub 2019 May 9.
• [2] The Prognostic Significance of Protein Expression of CASZ1 in Clear Cell Renal Cell Carcinoma.Dis Markers. 2019 Aug 6;2019:1342161. doi: 10.1155/2019/1342161. eCollection 2019.
• [3] Catestatin Inhibits Obesity-Induced Macrophage Infiltration and Inflammation in the Liver and Suppresses Hepatic Glucose Production, Leading to Improved Insulin Sensitivity.Diabetes. 2018 May;67(5):841-848. doi: 10.2337/db17-0788. Epub 2018 Feb 6.
• [4] Identification of DNA methylation prognostic signature of acute myelocytic leukemia.PLoS One. 2018 Jun 22;13(6):e0199689. doi: 10.1371/journal.pone.0199689. eCollection 2018.
• [5] Downregulation of castor zinc finger 1 predicts poor prognosis and facilitates hepatocellular carcinoma progression via MAPK/ERK signaling.J Exp Clin Cancer Res. 2018 Mar 5;37(1):45. doi: 10.1186/s13046-018-0720-8.
• [6] Expression of Somatostatin, cortistatin, and their receptors, as well as dopamine receptors, but not of neprilysin, are reduced in the temporal lobe of Alzheimer's disease patients.J Alzheimers Dis. 2010;20(2):465-75. doi: 10.3233/JAD-2010-1385.
• [7] Decreased circulating catestatin levels are associated with coronary artery disease: The emerging anti-inflammatory role.Atherosclerosis. 2019 Feb;281:78-88. doi: 10.1016/j.atherosclerosis.2018.12.025. Epub 2018 Dec 24.
• [8] Multi-ethnic genome-wide association study for atrial fibrillation.Nat Genet. 2018 Jun 11;50(9):1225-1233. doi: 10.1038/s41588-018-0133-9.
• [9] The Relationship of Immune Cell Signatures to Patient Survival Varies within and between Tumor Types.PLoS One. 2015 Sep 23;10(9):e0138726. doi: 10.1371/journal.pone.0138726. eCollection 2015.
• [10] Catestatin: A Master Regulator of Cardiovascular Functions.Curr Med Chem. 2018;25(11):1352-1374. doi: 10.2174/0929867324666170425100416.
• [11] Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
• [12] Surgical Treatment of Early-Stage Cervical Cancer: A Multi-Institution Experience in 2124 Cases in The Netherlands Over a 30-Year Period.Int J Gynecol Cancer. 2018 May;28(4):757-763. doi: 10.1097/IGC.0000000000001228.
• [13] Integral analyses of survival-related long non-coding RNA MIR210HG and its prognostic role in colon cancer.Oncol Lett. 2019 Aug;18(2):1107-1116. doi: 10.3892/ol.2019.10435. Epub 2019 Jun 4.
• [14] Identifying factors associated with the direction and significance of microRNA tumor-normal expression differences in colorectal cancer.BMC Cancer. 2017 Oct 30;17(1):707. doi: 10.1186/s12885-017-3690-x.
• [15] A novel de novo CASZ1 heterozygous frameshift variant causes dilated cardiomyopathy and left ventricular noncompaction cardiomyopathy.Mol Genet Genomic Med. 2019 Aug;7(8):e828. doi: 10.1002/mgg3.828. Epub 2019 Jul 3.
• [16] Survival implications of time to surgical treatment of endometrial cancers.Am J Obstet Gynecol. 2017 Mar;216(3):268.e1-268.e18. doi: 10.1016/j.ajog.2016.11.1050. Epub 2016 Dec 9.
• [17] Longer genotypically-estimated leukocyte telomere length is associated with increased adult glioma risk.Oncotarget. 2015 Dec 15;6(40):42468-77. doi: 10.18632/oncotarget.6468.
• [18] Identification of survival-related predictors in hepatocellular carcinoma through integrated genomic, transcriptomic, and proteomic analyses.Biomed Pharmacother. 2019 Jun;114:108856. doi: 10.1016/j.biopha.2019.108856. Epub 2019 Apr 10.
• [19] Genome-Wide Association Study of Apparent Treatment-Resistant Hypertension in the CHARGE Consortium: The CHARGE Pharmacogenetics Working Group.Am J Hypertens. 2019 Nov 15;32(12):1146-1153. doi: 10.1093/ajh/hpz150.
• [20] Gender-associated differences in lung cancer: clinical characteristics and treatment outcomes in women.Semin Oncol. 2009 Dec;36(6):572-80. doi: 10.1053/j.seminoncol.2009.10.007.
• [21] Catestatin in Acutely Decompensated Heart Failure Patients: Insights from the CATSTAT-HF Study.J Clin Med. 2019 Jul 30;8(8):1132. doi: 10.3390/jcm8081132.
• [22] A gender specific improved survival related to stromal miR-143 and miR-145 expression in non-small cell lung cancer.Sci Rep. 2018 Jun 4;8(1):8549. doi: 10.1038/s41598-018-26864-w.
• [23] Cost-Effectiveness of Novel Agents in Medicare Patients with Multiple Myeloma: Findings from a U.S. Payer's Perspective.J Manag Care Spec Pharm. 2017 Aug;23(8):831-843. doi: 10.18553/jmcp.2017.23.8.831.
• [24] Sequencing of prostate cancers identifies new cancer genes, routes of progression and drug targets.Nat Genet. 2018 May;50(5):682-692. doi: 10.1038/s41588-018-0086-z. Epub 2018 Apr 16.
• [25] Does Subclassification of Pathologically Organ Confined (pT2) Prostate Cancer Provide Prognostic Discrimination of Outcomes after Radical Prostatectomy?.J Urol. 2018 Jun;199(6):1502-1509. doi: 10.1016/j.juro.2017.12.056. Epub 2018 Jan 4.
• [26] Catestatin Regulates Epithelial Cell Dynamics to Improve Intestinal Inflammation.Vaccines (Basel). 2018 Sep 20;6(4):67. doi: 10.3390/vaccines6040067.
• [27] Varicose veins of lower extremities: Insights from the first large-scale genetic study.PLoS Genet. 2019 Apr 18;15(4):e1008110. doi: 10.1371/journal.pgen.1008110. eCollection 2019 Apr.
• [28] The same cortico-efferent tract involvement in progressive bulbar palsy and in 'classical' ALS: A tract of interest-based MRI study.Neuroimage Clin. 2019;24:101979. doi: 10.1016/j.nicl.2019.101979. Epub 2019 Aug 9.
• [29] Expression profiling of T-cell lymphomas differentiates peripheral and lymphoblastic lymphomas and defines survival related genes.Clin Cancer Res. 2004 Aug 1;10(15):4971-82. doi: 10.1158/1078-0432.CCR-04-0269.
• [30] Catestatin Enhances Neuropathic Pain Mediated by P2X4 Receptor of Dorsal Root Ganglia in a Rat Model of Chronic Constriction Injury.Cell Physiol Biochem. 2018;51(2):812-826. doi: 10.1159/000495334. Epub 2018 Nov 21.
• [31] Catestatin as a Target for Treatment of Inflammatory Diseases.Front Immunol. 2018 Oct 4;9:2199. doi: 10.3389/fimmu.2018.02199. eCollection 2018.
• [32] Immense Insulin Intestinal Uptake and Lymphatic Transport Using Bile Acid Conjugated Partially Uncapped Liposome.Mol Pharm. 2018 Oct 1;15(10):4756-4763. doi: 10.1021/acs.molpharmaceut.8b00708. Epub 2018 Aug 29.
• [33] Genetic prediction of male pattern baldness.PLoS Genet. 2017 Feb 14;13(2):e1006594. doi: 10.1371/journal.pgen.1006594. eCollection 2017 Feb.
• [34] Genetic overlap of chronic obstructive pulmonary disease and cardiovascular disease-related traits: a large-scale genome-wide cross-trait analysis.Respir Res. 2019 Apr 2;20(1):64. doi: 10.1186/s12931-019-1036-8.
• [35] Circulating levels of cortistatin are correlated with metabolic parameters in patients with newly diagnosed type 2 diabetes mellitus.Peptides. 2017 Aug;94:86-90. doi: 10.1016/j.peptides.2017.05.008. Epub 2017 May 17.
• [36] Cortistatin binds to TNF- receptors and protects against osteoarthritis.EBioMedicine. 2019 Mar;41:556-570. doi: 10.1016/j.ebiom.2019.02.035. Epub 2019 Feb 28.
• [37] Multiancestry genome-wide association study of 520,000 subjects identifies 32 loci associated with stroke and stroke subtypes.Nat Genet. 2018 Apr;50(4):524-537. doi: 10.1038/s41588-018-0058-3. Epub 2018 Mar 12.
• [38] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [39] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [40] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [41] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [42] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [43] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [44] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [45] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [46] Genetic and epigenetic changes in the common 1p36 deletion in neuroblastoma tumours. Br J Cancer. 2007 Nov 19;97(10):1416-24. doi: 10.1038/sj.bjc.6604032. Epub 2007 Oct 16.
• [47] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [48] Synergistic effect of JQ1 and rapamycin for treatment of human osteosarcoma. Int J Cancer. 2015 May 1;136(9):2055-64.
• [49] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [50] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [51] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.