Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0DCUOM)

• DOT Name: Ephrin-B2 (EFNB2)
• Synonyms: EPH-related receptor tyrosine kinase ligand 5; LERK-5; HTK ligand; HTK-L
• Gene Name: EFNB2
• Related Disease:
  Arthritis
  Astrocytoma
  Esophageal squamous cell carcinoma
  Glioblastoma multiforme
  Rheumatoid arthritis
  Type-1/2 diabetes
  B-cell lymphoma
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Carcinoma
  Carcinoma of esophagus
  Cardiovascular disease
  Colon cancer
  Colon carcinoma
  Colonic neoplasm
  Colorectal carcinoma
  Glioma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Kaposi sarcoma
  Liver cancer
  Lung adenocarcinoma
  Lung cancer
  Lung neoplasm
  Neoplasm
  Osteoarthritis
  Precancerous condition
  Schizophrenia
  Squamous cell carcinoma
  Thyroid gland carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  High blood pressure
  leukaemia
  Leukemia
  Pancreatic cancer
  Advanced cancer
  Crohn disease
  Gastric cancer
  Intellectual disability
  Matthew-Wood syndrome
  Nephropathy
  Neuroblastoma
  Non-insulin dependent diabetes
  Pancreatic ductal carcinoma
  Stomach cancer
• UniProt ID: EFNB2_HUMAN
• PDB ID: 2HLE; 2I85; 2VSK; 2VSM; 2WO2; 3GXU; 4UF7; 6P7Y; 6PDL
• Pfam ID: PF00812
• Sequence:
  MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDI
  ICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPN
  LWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNKDPT
  RRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILGSEVALFAGIASGCIIFIV
  IIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVF
  CPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
• Function: Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Binds to receptor tyrosine kinase including EPHA4, EPHA3 and EPHB4. Together with EPHB4 plays a central role in heart morphogenesis and angiogenesis through regulation of cell adhesion and cell migration. EPHB4-mediated forward signaling controls cellular repulsion and segregation from EFNB2-expressing cells. May play a role in constraining the orientation of longitudinally projecting axons; (Microbial infection) Acts as a receptor for Hendra virus and Nipah virus.
• Tissue Specificity: Lung and kidney.
• KEGG Pathway: Axon guidance (hsa04360)
• Reactome Pathway:
  EPHB-mediated forward signaling (R-HSA-3928662)
  Ephrin signaling (R-HSA-3928664)
  EPH-ephrin mediated repulsion of cells (R-HSA-3928665)
  EPH-Ephrin signaling (R-HSA-2682334)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Arthritis	DIST1YEL	Definitive	Biomarker	[1]
Astrocytoma	DISL3V18	Definitive	Biomarker	[2]
Esophageal squamous cell carcinoma	DIS5N2GV	Definitive	Altered Expression	[3]
Glioblastoma multiforme	DISK8246	Definitive	Posttranslational Modification	[2]
Rheumatoid arthritis	DISTSB4J	Definitive	Altered Expression	[1]
Type-1/2 diabetes	DISIUHAP	Definitive	Altered Expression	[4]
B-cell lymphoma	DISIH1YQ	Strong	Altered Expression	[5]
Bladder cancer	DISUHNM0	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Carcinoma	DISH9F1N	Strong	Altered Expression	[8]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[9]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[10]
Colon cancer	DISVC52G	Strong	Altered Expression	[11]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[11]
Colonic neoplasm	DISSZ04P	Strong	Altered Expression	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[12]
Glioma	DIS5RPEH	Strong	Altered Expression	[2]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[14]
Kaposi sarcoma	DISC1H1Z	Strong	Altered Expression	[15]
Liver cancer	DISDE4BI	Strong	Biomarker	[16]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[17]
Lung cancer	DISCM4YA	Strong	Biomarker	[18]
Lung neoplasm	DISVARNB	Strong	Biomarker	[18]
Neoplasm	DISZKGEW	Strong	Biomarker	[19]
Osteoarthritis	DIS05URM	Strong	Biomarker	[20]
Precancerous condition	DISV06FL	Strong	Biomarker	[16]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[21]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[22]
Thyroid gland carcinoma	DISMNGZ0	Strong	Altered Expression	[23]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[6]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[6]
High blood pressure	DISY2OHH	moderate	Biomarker	[24]
leukaemia	DISS7D1V	moderate	Biomarker	[25]
Leukemia	DISNAKFL	moderate	Biomarker	[25]
Pancreatic cancer	DISJC981	moderate	Biomarker	[26]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[19]
Crohn disease	DIS2C5Q8	Limited	Altered Expression	[27]
Gastric cancer	DISXGOUK	Limited	Biomarker	[28]
Intellectual disability	DISMBNXP	Limited	Genetic Variation	[29]
Matthew-Wood syndrome	DISA7HR7	Limited	Biomarker	[30]
Nephropathy	DISXWP4P	Limited	Biomarker	[31]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[32]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[31]
Pancreatic ductal carcinoma	DIS26F9Q	Limited	Biomarker	[30]
Stomach cancer	DISKIJSX	Limited	Biomarker	[28]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Ephrin-B2 (EFNB2).	[33]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Ephrin-B2 (EFNB2).	[34]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Ephrin-B2 (EFNB2).	[35]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Ephrin-B2 (EFNB2).	[36]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Ephrin-B2 (EFNB2).	[37]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Ephrin-B2 (EFNB2).	[38]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Ephrin-B2 (EFNB2).	[39]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Ephrin-B2 (EFNB2).	[40]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Ephrin-B2 (EFNB2).	[41]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Ephrin-B2 (EFNB2).	[42]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Ephrin-B2 (EFNB2).	[43]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Ephrin-B2 (EFNB2).	[44]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Ephrin-B2 (EFNB2).	[45]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Ephrin-B2 (EFNB2).	[46]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Ephrin-B2 (EFNB2).	[47]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Ephrin-B2 (EFNB2).	[48]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Ephrin-B2 (EFNB2).	[37]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Ephrin-B2 (EFNB2).	[49]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 increases the expression of Ephrin-B2 (EFNB2).	[50]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Ephrin-B2 (EFNB2).	[52]
Mivebresib	DMCPF90	Phase 1	Mivebresib increases the expression of Ephrin-B2 (EFNB2).	[50]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Ephrin-B2 (EFNB2).	[53]
SB-431542	DM0YOXQ	Preclinical	SB-431542 increases the expression of Ephrin-B2 (EFNB2).	[54]
Celastrol	DMWQIJX	Preclinical	Celastrol decreases the expression of Ephrin-B2 (EFNB2).	[55]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Ephrin-B2 (EFNB2).	[37]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Ephrin-B2 (EFNB2).	[56]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Ephrin-B2 (EFNB2).	[57]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Ephrin-B2 (EFNB2).	[58]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Ephrin-B2 (EFNB2).	[59]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Ephrin-B2 (EFNB2).	[60]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Ephrin-B2 (EFNB2).	[61]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Ephrin-B2 (EFNB2).	[51]

References

• [1] Role of EFNB1 and EFNB2 in Mouse Collagen-Induced Arthritis and Human Rheumatoid Arthritis.Arthritis Rheumatol. 2015 Jul;67(7):1778-88. doi: 10.1002/art.39116.
• [2] The phosphorylation of ephrin-B2 ligand promotes glioma cell migration and invasion.Int J Cancer. 2010 Mar 1;126(5):1155-65. doi: 10.1002/ijc.24849.
• [3] Down-regulation of EphB4 phosphorylation is necessary for esophageal squamous cell carcinoma tumorigenecity.Tumour Biol. 2014 Jul;35(7):7225-32. doi: 10.1007/s13277-014-1955-4. Epub 2014 Apr 27.
• [4] Inhibition of Ephrin-B2 in brain pericytes decreases cerebral pathological neovascularization in diabetic rats.PLoS One. 2019 Jan 8;14(1):e0210523. doi: 10.1371/journal.pone.0210523. eCollection 2019.
• [5] Genomic Profile and Pathologic Features of Diffuse Large B-Cell Lymphoma Subtype of Methotrexate-associated Lymphoproliferative Disorder in Rheumatoid Arthritis Patients.Am J Surg Pathol. 2018 Jul;42(7):936-950. doi: 10.1097/PAS.0000000000001071.
• [6] Exploring the FGFR3-related oncogenic mechanism in bladder cancer using bioinformatics strategy.World J Surg Oncol. 2017 Mar 20;15(1):66. doi: 10.1186/s12957-017-1125-4.
• [7] EphrinB2 inhibits cell proliferation and motility invitro and predicts longer metastasisfree survival in breast cancer.Int J Oncol. 2019 Dec;55(6):1275-1286. doi: 10.3892/ijo.2019.4892. Epub 2019 Oct 4.
• [8] LPA/PKD-1-FoxO1 Signaling Axis Mediates Endothelial Cell CD36 Transcriptional Repression and Proangiogenic and Proarteriogenic Reprogramming.Arterioscler Thromb Vasc Biol. 2016 Jun;36(6):1197-208. doi: 10.1161/ATVBAHA.116.307421. Epub 2016 Mar 24.
• [9] Expression and prognostic significance of EFNB2 and EphB4 genes in patients with oesophageal squamous cell carcinoma.Dig Liver Dis. 2007 Aug;39(8):725-32. doi: 10.1016/j.dld.2007.05.013. Epub 2007 Jul 3.
• [10] Chromosome 13q deletion syndrome involving 13q31qter: A case report.Mol Med Rep. 2017 Jun;15(6):3658-3664. doi: 10.3892/mmr.2017.6425. Epub 2017 Apr 3.
• [11] Effects of overexpression of ephrin-B2 on tumour growth in human colorectal cancer.Br J Cancer. 2004 Apr 19;90(8):1620-6. doi: 10.1038/sj.bjc.6601723.
• [12] DNA damage-induced ephrin-B2 reverse signaling promotes chemoresistance and drives EMT in colorectal carcinoma harboring mutant p53.Cell Death Differ. 2016 Apr;23(4):707-22. doi: 10.1038/cdd.2015.133. Epub 2015 Oct 23.
• [13] Inhibition of EphB4-Ephrin-B2 Signaling Reprograms the Tumor Immune Microenvironment in Head and Neck Cancers.Cancer Res. 2019 May 15;79(10):2722-2735. doi: 10.1158/0008-5472.CAN-18-3257. Epub 2019 Mar 20.
• [14] Tumor-endothelial cell interaction in an experimental model of human hepatocellular carcinoma.Exp Cell Res. 2018 Nov 1;372(1):16-24. doi: 10.1016/j.yexcr.2018.09.001. Epub 2018 Sep 8.
• [15] The role of Ephs, Ephrins, and growth factors in Kaposi sarcoma and implications of EphrinB2 blockade.Blood. 2009 Jan 1;113(1):254-63. doi: 10.1182/blood-2008-02-140020. Epub 2008 Oct 3.
• [16] Multiple genes exhibit phenobarbital-induced constitutive active/androstane receptor-mediated DNA methylation changes during liver tumorigenesis and in liver tumors.Toxicol Sci. 2009 Apr;108(2):273-89. doi: 10.1093/toxsci/kfp031. Epub 2009 Feb 20.
• [17] Upregulation of HOXA11 during the progression of lung adenocarcinoma detected via multiple approaches.Int J Mol Med. 2018 Nov;42(5):2650-2664. doi: 10.3892/ijmm.2018.3826. Epub 2018 Aug 14.
• [18] Bronchial airway gene expression signatures in mouse lung squamous cell carcinoma and their modulation by cancer chemopreventive agents.Oncotarget. 2017 Mar 21;8(12):18885-18900. doi: 10.18632/oncotarget.13806.
• [19] Ligand-dependent EphB4 activation serves as an anchoring signal in glioma cells.Cancer Lett. 2019 May 1;449:56-65. doi: 10.1016/j.canlet.2019.02.021. Epub 2019 Feb 15.
• [20] Activation of the receptor EphB4 by its specific ligand ephrin B2 in human osteoarthritic subchondral bone osteoblasts.Arthritis Rheum. 2008 Dec;58(12):3820-30. doi: 10.1002/art.24029.
• [21] Association of EPHB1 rs11918092 and EFNB2 rs9520087 with psychopathological symptoms of schizophrenia in Chinese Zhuang and Han populations.Asia Pac Psychiatry. 2016 Dec;8(4):306-308. doi: 10.1111/appy.12241. Epub 2016 Mar 29.
• [22] Ephrin-B2 overexpression predicts for poor prognosis and response to therapy in solid tumors.Mol Carcinog. 2017 Mar;56(3):1189-1196. doi: 10.1002/mc.22574. Epub 2016 Nov 1.
• [23] Diagnostic and prognostic value of angiogenesis-modulating genes in malignant thyroid neoplasms.Surgery. 2005 Dec;138(6):1102-9; discussion 1109-10. doi: 10.1016/j.surg.2005.05.025.
• [24] Reduced blood pressure after smooth muscle EFNB2 deletion and the potential association of EFNB2 mutation with human hypertension risk.Eur J Hum Genet. 2016 Dec;24(12):1817-1825. doi: 10.1038/ejhg.2016.105. Epub 2016 Aug 17.
• [25] Effect of EPH-ephrin signaling on the growth of human leukemia cells.Anticancer Res. 2014 Jun;34(6):2913-8.
• [26] Integrated microRNA-mRNA analysis of pancreatic ductal adenocarcinoma.Genet Mol Res. 2015 Aug 28;14(3):10288-97. doi: 10.4238/2015.August.28.14.
• [27] Ephrin-B2 is differentially expressed in the intestinal epithelium in Crohn's disease and contributes to accelerated epithelial wound healing in vitro.World J Gastroenterol. 2005 Jul 14;11(26):4024-31. doi: 10.3748/wjg.v11.i26.4024.
• [28] High serum Ephrin-B2 levels predict poor prognosis for patients with gastric cancer.Oncol Lett. 2018 Oct;16(4):4455-4461. doi: 10.3892/ol.2018.9202. Epub 2018 Jul 24.
• [29] EFNB2 haploinsufficiency causes a syndromic neurodevelopmental disorder.Clin Genet. 2018 Jun;93(6):1141-1147. doi: 10.1111/cge.13234. Epub 2018 Mar 15.
• [30] EFNB2 acts as the target of miR-557 to facilitate cell proliferation, migration and invasion in pancreatic ductal adenocarcinoma by bioinformatics analysis and verification.Am J Transl Res. 2018 Nov 15;10(11):3514-3528. eCollection 2018.
• [31] Association analysis of the ephrin-B2 gene in African-Americans with end-stage renal disease.Am J Nephrol. 2008;28(6):914-20. doi: 10.1159/000141934. Epub 2008 Jun 26.
• [32] De novo identification of MIZ-1 (ZBTB17) encoding a MYC-interacting zinc-finger protein as a new favorable neuroblastoma gene.Clin Cancer Res. 2007 Oct 15;13(20):6001-9. doi: 10.1158/1078-0432.CCR-07-0071.
• [33] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [34] Role of all-trans retinoic acid in neurite outgrowth and axonal elongation. J Neurobiol. 2006 Jun;66(7):739-56. doi: 10.1002/neu.20241.
• [35] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [36] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [37] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [38] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [39] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [40] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [41] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [42] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [43] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [44] Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
• [45] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [46] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [47] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [48] Molecular mechanisms of action of angiopreventive anti-oxidants on endothelial cells: microarray gene expression analyses. Mutat Res. 2005 Dec 11;591(1-2):198-211.
• [49] Gene expression preferentially regulated by tamoxifen in breast cancer cells and correlations with clinical outcome. Cancer Res. 2006 Jul 15;66(14):7334-40.
• [50] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
• [51] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [52] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [53] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [54] Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
• [55] Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
• [56] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [57] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [58] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [59] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [60] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [61] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.