Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1M5B95)

• DOT Name: B-cell lymphoma 3 protein (BCL3)
• Synonyms: BCL-3; Proto-oncogene BCL3
• Gene Name: BCL3
• Related Disease:
  Alzheimer disease
  Small lymphocytic lymphoma
  Advanced cancer
  Anaplastic large cell lymphoma
  Arteriosclerosis
  Atherosclerosis
  Autoimmune disease
  B-cell neoplasm
  Breast carcinoma
  Cardiovascular disease
  Classic Hodgkin lymphoma
  Colorectal carcinoma
  Coronary heart disease
  Epithelial ovarian cancer
  Glioblastoma multiforme
  Glioma
  Hepatitis B virus infection
  Hepatocellular carcinoma
  leukaemia
  Leukemia
  Lymphoproliferative syndrome
  Multiple sclerosis
  Myotonic dystrophy
  Neoplasm
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
  Plasma cell myeloma
  Psoriasis
  Triple negative breast cancer
  Ulcerative colitis
  Adult glioblastoma
  Breast neoplasm
  Lymphoma
  Melanoma
  Non-hodgkin lymphoma
  Acute myelogenous leukaemia
  Atopic dermatitis
  B-cell lymphoma
  Breast cancer
  Chromosomal disorder
  Colitis
  Crohn disease
  Follicular lymphoma
  Inflammatory bowel disease
  Nasopharyngeal carcinoma
  Prostate cancer
  Prostate carcinoma
  Rheumatoid arthritis
• UniProt ID: BCL3_HUMAN
• PDB ID: 1K1A; 1K1B
• Pfam ID: PF00023 ; PF12796
• Sequence:
  MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPL
  RGGCDLPAVPGPPHGLARPEALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHP
  LSADIAMATRADEDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAV
  ITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNY
  DGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGA
  NVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG
  KATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPSSSPSQSPPRDPPGFPMAPPN
  FFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS
• Function: Contributes to the regulation of transcriptional activation of NF-kappa-B target genes. In the cytoplasm, inhibits the nuclear translocation of the NF-kappa-B p50 subunit. In the nucleus, acts as transcriptional activator that promotes transcription of NF-kappa-B target genes. Contributes to the regulation of cell proliferation.
• KEGG Pathway:
  C-type lectin receptor sig.ling pathway (hsa04625)
  TNF sig.ling pathway (hsa04668)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alzheimer disease	DISF8S70	Definitive	Genetic Variation	[1]
Small lymphocytic lymphoma	DIS30POX	Definitive	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Anaplastic large cell lymphoma	DISP4D1R	Strong	Altered Expression	[4]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[5]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[5]
Autoimmune disease	DISORMTM	Strong	Genetic Variation	[6]
B-cell neoplasm	DISVY326	Strong	Genetic Variation	[3]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[5]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Genetic Variation	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[3]
Coronary heart disease	DIS5OIP1	Strong	Genetic Variation	[5]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[9]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[10]
Glioma	DIS5RPEH	Strong	Biomarker	[10]
Hepatitis B virus infection	DISLQ2XY	Strong	Altered Expression	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[12]
leukaemia	DISS7D1V	Strong	Biomarker	[13]
Leukemia	DISNAKFL	Strong	Biomarker	[13]
Lymphoproliferative syndrome	DISMVL8O	Strong	Genetic Variation	[14]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[15]
Myotonic dystrophy	DISNBEMX	Strong	Biomarker	[16]
Neoplasm	DISZKGEW	Strong	Biomarker	[3]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[17]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[9]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[9]
Plasma cell myeloma	DIS0DFZ0	Strong	Altered Expression	[18]
Psoriasis	DIS59VMN	Strong	Biomarker	[19]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[20]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[21]
Adult glioblastoma	DISVP4LU	moderate	Biomarker	[22]
Breast neoplasm	DISNGJLM	moderate	Biomarker	[7]
Lymphoma	DISN6V4S	moderate	Altered Expression	[23]
Melanoma	DIS1RRCY	moderate	Biomarker	[24]
Non-hodgkin lymphoma	DISS2Y8A	Disputed	Altered Expression	[25]
Acute myelogenous leukaemia	DISCSPTN	Limited	Biomarker	[2]
Atopic dermatitis	DISTCP41	Limited	Biomarker	[26]
B-cell lymphoma	DISIH1YQ	Limited	Biomarker	[27]
Breast cancer	DIS7DPX1	Limited	Altered Expression	[7]
Chromosomal disorder	DISM5BB5	Limited	Genetic Variation	[28]
Colitis	DISAF7DD	Limited	Biomarker	[29]
Crohn disease	DIS2C5Q8	Limited	Biomarker	[21]
Follicular lymphoma	DISVEUR6	Limited	Genetic Variation	[13]
Inflammatory bowel disease	DISGN23E	Limited	Altered Expression	[29]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Biomarker	[30]
Prostate cancer	DISF190Y	Limited	Altered Expression	[31]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[31]
Rheumatoid arthritis	DISTSB4J	Limited	Altered Expression	[32]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of B-cell lymphoma 3 protein (BCL3).	[33]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of B-cell lymphoma 3 protein (BCL3).	[55]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of B-cell lymphoma 3 protein (BCL3).	[58]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of B-cell lymphoma 3 protein (BCL3).	[34]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of B-cell lymphoma 3 protein (BCL3).	[35]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of B-cell lymphoma 3 protein (BCL3).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of B-cell lymphoma 3 protein (BCL3).	[37]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of B-cell lymphoma 3 protein (BCL3).	[38]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of B-cell lymphoma 3 protein (BCL3).	[34]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of B-cell lymphoma 3 protein (BCL3).	[39]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of B-cell lymphoma 3 protein (BCL3).	[40]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of B-cell lymphoma 3 protein (BCL3).	[41]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of B-cell lymphoma 3 protein (BCL3).	[42]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of B-cell lymphoma 3 protein (BCL3).	[43]
Selenium	DM25CGV	Approved	Selenium increases the expression of B-cell lymphoma 3 protein (BCL3).	[44]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of B-cell lymphoma 3 protein (BCL3).	[45]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of B-cell lymphoma 3 protein (BCL3).	[46]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of B-cell lymphoma 3 protein (BCL3).	[47]
Menthol	DMG2KW7	Approved	Menthol increases the expression of B-cell lymphoma 3 protein (BCL3).	[48]
Fenofibrate	DMFKXDY	Approved	Fenofibrate decreases the expression of B-cell lymphoma 3 protein (BCL3).	[34]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of B-cell lymphoma 3 protein (BCL3).	[34]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of B-cell lymphoma 3 protein (BCL3).	[49]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of B-cell lymphoma 3 protein (BCL3).	[50]
Pelitinib	DMIW453	Phase 2	Pelitinib decreases the expression of B-cell lymphoma 3 protein (BCL3).	[51]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of B-cell lymphoma 3 protein (BCL3).	[52]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of B-cell lymphoma 3 protein (BCL3).	[53]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of B-cell lymphoma 3 protein (BCL3).	[54]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of B-cell lymphoma 3 protein (BCL3).	[56]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of B-cell lymphoma 3 protein (BCL3).	[57]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride increases the expression of B-cell lymphoma 3 protein (BCL3).	[59]

References

• [1] Shared genetic architecture between metabolic traits and Alzheimer's disease: a large-scale genome-wide cross-trait analysis.Hum Genet. 2019 Mar;138(3):271-285. doi: 10.1007/s00439-019-01988-9. Epub 2019 Feb 25.
• [2] BCL3 Expression Is a Potential Prognostic and Predictive Biomarker in Acute Myeloid Leukemia of FAB Subtype M2.Pathol Oncol Res. 2019 Apr;25(2):541-548. doi: 10.1007/s12253-018-0476-7. Epub 2018 Oct 25.
• [3] BCL-3 promotes a cancer stem cell phenotype by enhancing -catenin signalling in colorectal tumour cells.Dis Model Mech. 2019 Mar 4;12(3):dmm037697. doi: 10.1242/dmm.037697.
• [4] Reappraisal of BCL3 as a molecular marker of anaplastic large cell lymphoma.Int J Hematol. 2005 Dec;82(5):397-405. doi: 10.1532/IJH97.05045.
• [5] An integrated genomic-transcriptomic approach supports a role for the proto-oncogene BCL3 in atherosclerosis.Thromb Haemost. 2015 Mar;113(3):655-63. doi: 10.1160/TH14-05-0466. Epub 2014 Nov 6.
• [6] Common and specific signatures of gene expression and protein-protein interactions in autoimmune diseases.Genes Immun. 2013 Mar;14(2):67-82. doi: 10.1038/gene.2012.55. Epub 2012 Nov 29.
• [7] Bcl-3 regulates TGF signaling by stabilizing Smad3 during breast cancer pulmonary metastasis.Cell Death Dis. 2016 Dec 1;7(12):e2508. doi: 10.1038/cddis.2016.405.
• [8] BCL2 and BCL3 are recurrent translocation partners of the IGH locus.Cancer Genet Cytogenet. 2008 Oct 15;186(2):110-4. doi: 10.1016/j.cancergencyto.2008.06.007.
• [9] The proto-oncogene Bcl3 induces immune checkpoint PD-L1 expression, mediating proliferation of ovarian cancer cells.J Biol Chem. 2018 Oct 5;293(40):15483-15496. doi: 10.1074/jbc.RA118.004084. Epub 2018 Aug 22.
• [10] BCL3 expression promotes resistance to alkylating chemotherapy in gliomas.Sci Transl Med. 2018 Jul 4;10(448):eaar2238. doi: 10.1126/scitranslmed.aar2238.
• [11] BCL-3 promotes the tumor growth of hepatocellular carcinoma by regulating cell proliferation and the cell cycle through cyclin D1.Oncol Rep. 2016 Apr;35(4):2382-90. doi: 10.3892/or.2016.4616. Epub 2016 Feb 11.
• [12] MicroRNA-627-5p inhibits the proliferation of hepatocellular carcinoma cells by targeting BCL3 transcription coactivator.Clin Exp Pharmacol Physiol. 2020 Mar;47(3):485-494. doi: 10.1111/1440-1681.13218. Epub 2019 Dec 21.
• [13] Molecular analysis of the BCL-3 locus at chromosome 17q22 in B-cell neoplasms.Blood. 1993 Sep 15;82(6):1813-9.
• [14] Preclinical validation of fluorescence in situ hybridization assays for clinical practice.Genet Med. 2006 Jan;8(1):16-23. doi: 10.1097/01.gim.0000195645.00446.61.
• [15] Balanced Bcl-3 expression in murine CD4(+) Tcells is required for generation of encephalitogenic Th17 cells.Eur J Immunol. 2017 Aug;47(8):1335-1341. doi: 10.1002/eji.201746933. Epub 2017 Jun 29.
• [16] Myotonic dystrophy: molecular analysis of Israeli patients.Biomed Pharmacother. 1994;48(8-9):373-80. doi: 10.1016/0753-3322(94)90054-x.
• [17] Expression Of Intracellular Components of the NF-B Alternative Pathway (NF-B2, RelB, NIK and Bcl3) is Associated With Clinical Outcome of NSCLC Patients.Sci Rep. 2019 Oct 4;9(1):14299. doi: 10.1038/s41598-019-50528-y.
• [18] High expression of BCL3 in human myeloma cells is associated with increased proliferation and inferior prognosis.Eur J Haematol. 2009 May;82(5):354-63. doi: 10.1111/j.1600-0609.2009.01225.x. Epub 2009 Jan 13.
• [19] Bcl-3 induced by IL-22 via STAT3 activation acts as a potentiator of psoriasis-related gene expression in epidermal keratinocytes.Eur J Immunol. 2018 Jan;48(1):168-179. doi: 10.1002/eji.201747017. Epub 2017 Nov 20.
• [20] Bcl-3 promotes proliferation and chemosensitivity in BL1 subtype of TNBC cells.Acta Biochim Biophys Sin (Shanghai). 2018 Nov 1;50(11):1141-1149. doi: 10.1093/abbs/gmy117.
• [21] Differential expression of key regulators of Toll-like receptors in ulcerative colitis and Crohn's disease: a role for Tollip and peroxisome proliferator-activated receptor gamma?.Clin Exp Immunol. 2016 Mar;183(3):358-68. doi: 10.1111/cei.12732. Epub 2015 Nov 26.
• [22] B-cell CLL/lymphoma 3 promotes glioma cell proliferation and inhibits apoptosis through the oncogenic STAT3 pathway.Int J Oncol. 2016 Dec;49(6):2471-2479. doi: 10.3892/ijo.2016.3729. Epub 2016 Oct 12.
• [23] Stimulation of CD30 in anaplastic large cell lymphoma leads to production of nuclear factor-kappaB p52, which is associated with hyperphosphorylated Bcl-3.Cancer Sci. 2005 Aug;96(8):487-97. doi: 10.1111/j.1349-7006.2005.00078.x.
• [24] Downregulation of cylindromatosis gene, CYLD, confers a growth advantage on malignant melanoma cells while negatively regulating their migration activity.Int J Oncol. 2012 Jul;41(1):53-60. doi: 10.3892/ijo.2012.1424. Epub 2012 Apr 2.
• [25] Elevated NF-kappaB p50 complex formation and Bcl-3 expression in classical Hodgkin, anaplastic large-cell, and other peripheral T-cell lymphomas.Blood. 2005 Dec 15;106(13):4287-93. doi: 10.1182/blood-2004-09-3620. Epub 2005 Aug 25.
• [26] Bcl-3 acts as an innate immune modulator by controlling antimicrobial responses in keratinocytes.J Invest Dermatol. 2009 Sep;129(9):2148-55. doi: 10.1038/jid.2009.49. Epub 2009 Mar 12.
• [27] The B-cell-activating factor signalling pathway is associated with Helicobacter pylori independence in gastric mucosa-associated lymphoid tissue lymphoma without t(11;18)(q21;q21).J Pathol. 2017 Feb;241(3):420-433. doi: 10.1002/path.4852. Epub 2016 Dec 29.
• [28] Chronic lymphocytic leukemia with t(14;19)(q32;q13) is characterized by atypical morphologic and immunophenotypic features and distinctive genetic features.Am J Clin Pathol. 2011 May;135(5):686-96. doi: 10.1309/AJCPOEFP3SLX6HXJ.
• [29] Elevated levels of Bcl-3 inhibits Treg development and function resulting in spontaneous colitis.Nat Commun. 2017 Apr 28;8:15069. doi: 10.1038/ncomms15069.
• [30] Constitutive activation of distinct NF-B signals in EBV-associated nasopharyngeal carcinoma.J Pathol. 2013 Nov;231(3):311-22. doi: 10.1002/path.4239. Epub 2013 Sep 3.
• [31] Expression of Id proteins is regulated by the Bcl-3 proto-oncogene in prostate cancer.Oncogene. 2013 Mar 21;32(12):1601-8. doi: 10.1038/onc.2012.175. Epub 2012 May 14.
• [32] Role of Bcl-3 in the development of follicular helper T cells and in the pathogenesis of rheumatoid arthritis.Arthritis Rheumatol. 2015 Oct;67(10):2651-60. doi: 10.1002/art.39266.
• [33] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [34] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [35] Effect of all-trans retinoic acid on sodium/iodide symporter expression, radioiodine uptake and gene expression profiles in a human anaplastic thyroid carcinoma cell line. Nucl Med Biol. 2006 Oct;33(7):875-82. doi: 10.1016/j.nucmedbio.2006.07.004.
• [36] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [39] Molecular mechanism of action of bisphenol and bisphenol A mediated by oestrogen receptor alpha in growth and apoptosis of breast cancer cells. Br J Pharmacol. 2013 May;169(1):167-78.
• [40] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [41] Cordycepin attenuates Salivary Hypofunction through the Prevention of Oxidative Stress in Human Submandibular Gland Cells. Int J Med Sci. 2020 Jul 6;17(12):1733-1743. doi: 10.7150/ijms.46707. eCollection 2020.
• [42] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [43] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [44] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [45] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [46] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [47] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [48] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [49] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [50] Epigallocatechin-3-gallate (EGCG) protects against chromate-induced toxicity in vitro. Toxicol Appl Pharmacol. 2012 Jan 15;258(2):166-75.
• [51] Irreversible EGFR inhibitor EKB-569 targets low-LET -radiation-triggered rel orchestration and potentiates cell death in squamous cell carcinoma. PLoS One. 2011;6(12):e29705. doi: 10.1371/journal.pone.0029705. Epub 2011 Dec 29.
• [52] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [53] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [54] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [55] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [56] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [57] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [58] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.
• [59] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.