Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5L6KD7)

• DOT Name: Protein NDRG2 (NDRG2)
• Synonyms: N-myc downstream-regulated gene 2 protein; Protein Syld709613
• Gene Name: NDRG2
• Related Disease:
  Cervical cancer
  Cervical carcinoma
  Pancreatic cancer
  Acute myelogenous leukaemia
  Adenoma
  Adult T-cell leukemia/lymphoma
  Advanced cancer
  Alzheimer disease
  Astrocytoma
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Cataract
  Cataract 20 multiple types
  Colon cancer
  Colonic neoplasm
  Colorectal carcinoma
  Esophageal squamous cell carcinoma
  Gastric cancer
  Glioma
  Hepatocellular carcinoma
  Human T-lymphotropic virus 1 infectious disease
  Liver cancer
  Meningioma
  Metastatic malignant neoplasm
  Multiple sclerosis
  Neuroblastoma
  Parkinson disease
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Squamous cell carcinoma
  Stomach cancer
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid tumor
  Urinary bladder cancer
  Urinary bladder neoplasm
  Adult glioblastoma
  Attention deficit hyperactivity disorder
  Clear cell renal carcinoma
  Colon carcinoma
  Depression
  Glioblastoma multiforme
  Stroke
• UniProt ID: NDRG2_HUMAN
• PDB ID: 2XMQ; 2XMR; 2XMS
• Pfam ID: PF03096
• Sequence:
  MAELQEVQITEEKPLLPGQTPEAAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPKP
  KRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPS
  LDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMD
  WAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNR
  RDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQP
  GKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSS
  GPPGHTMEVSC
• Function: Contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor. May be involved in dendritic cell and neuron differentiation.
• Tissue Specificity: Highly expressed in brain, heart, skeletal muscle and salivary gland, and moderately in kidney and liver. Expressed in dendritic cells, but not in other blood cells. Expression levels are low in pancreatic and liver cancer tissues; absent in meningioma. Expressed in low-grade gliomas but present at low levels in glioblastoma. Isoform 1 and isoform 2 are present in brain neurons and up-regulated in Alzheimer disease (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cervical cancer	DISFSHPF	Definitive	Biomarker	[1]
Cervical carcinoma	DIST4S00	Definitive	Biomarker	[1]
Pancreatic cancer	DISJC981	Definitive	Altered Expression	[2]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[3]
Adenoma	DIS78ZEV	Strong	Posttranslational Modification	[4]
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Altered Expression	[5]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[6]
Alzheimer disease	DISF8S70	Strong	Biomarker	[7]
Astrocytoma	DISL3V18	Strong	Biomarker	[8]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[9]
Breast cancer	DIS7DPX1	Strong	Biomarker	[10]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[10]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[11]
Carcinoma	DISH9F1N	Strong	Altered Expression	[12]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Biomarker	[13]
Cataract	DISUD7SL	Strong	Biomarker	[14]
Cataract 20 multiple types	DISN0IHS	Strong	Biomarker	[14]
Colon cancer	DISVC52G	Strong	Altered Expression	[15]
Colonic neoplasm	DISSZ04P	Strong	Biomarker	[16]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[17]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[18]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[19]
Glioma	DIS5RPEH	Strong	Biomarker	[20]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[6]
Human T-lymphotropic virus 1 infectious disease	DISN5C4M	Strong	Altered Expression	[21]
Liver cancer	DISDE4BI	Strong	Biomarker	[13]
Meningioma	DISPT4TG	Strong	Posttranslational Modification	[22]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[23]
Multiple sclerosis	DISB2WZI	Strong	Altered Expression	[24]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[25]
Parkinson disease	DISQVHKL	Strong	Biomarker	[20]
Prostate cancer	DISF190Y	Strong	Altered Expression	[26]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[26]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[27]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[28]
Stomach cancer	DISKIJSX	Strong	Posttranslational Modification	[29]
Thyroid cancer	DIS3VLDH	Strong	Altered Expression	[30]
Thyroid gland carcinoma	DISMNGZ0	Strong	Altered Expression	[31]
Thyroid tumor	DISLVKMD	Strong	Altered Expression	[30]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[9]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[9]
Adult glioblastoma	DISVP4LU	moderate	Altered Expression	[32]
Attention deficit hyperactivity disorder	DISL8MX9	Limited	Biomarker	[20]
Clear cell renal carcinoma	DISBXRFJ	Limited	Biomarker	[27]
Colon carcinoma	DISJYKUO	Limited	Altered Expression	[15]
Depression	DIS3XJ69	Limited	Biomarker	[20]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[32]
Stroke	DISX6UHX	Limited	Biomarker	[20]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Hydrogen peroxide	DM1NG5W	Approved	Protein NDRG2 (NDRG2) increases the response to substance of Hydrogen peroxide.	[14]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Protein NDRG2 (NDRG2).	[33]
G1	DMTV42K	Phase 1/2	G1 increases the phosphorylation of Protein NDRG2 (NDRG2).	[53]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Protein NDRG2 (NDRG2).	[55]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of Protein NDRG2 (NDRG2).	[57]

23 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Protein NDRG2 (NDRG2).	[34]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Protein NDRG2 (NDRG2).	[35]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Protein NDRG2 (NDRG2).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein NDRG2 (NDRG2).	[37]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein NDRG2 (NDRG2).	[38]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Protein NDRG2 (NDRG2).	[39]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Protein NDRG2 (NDRG2).	[40]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Protein NDRG2 (NDRG2).	[41]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Protein NDRG2 (NDRG2).	[42]
Phenobarbital	DMXZOCG	Approved	Phenobarbital decreases the expression of Protein NDRG2 (NDRG2).	[43]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Protein NDRG2 (NDRG2).	[44]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Protein NDRG2 (NDRG2).	[45]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Protein NDRG2 (NDRG2).	[46]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Protein NDRG2 (NDRG2).	[47]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Protein NDRG2 (NDRG2).	[48]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol decreases the expression of Protein NDRG2 (NDRG2).	[49]
Cocaine	DMSOX7I	Approved	Cocaine decreases the expression of Protein NDRG2 (NDRG2).	[50]
Genistein	DM0JETC	Phase 2/3	Genistein affects the expression of Protein NDRG2 (NDRG2).	[51]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Protein NDRG2 (NDRG2).	[52]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Protein NDRG2 (NDRG2).	[34]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Protein NDRG2 (NDRG2).	[54]
PMID27336223-Compound-5	DM6E50A	Patented	PMID27336223-Compound-5 decreases the expression of Protein NDRG2 (NDRG2).	[46]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Protein NDRG2 (NDRG2).	[56]

References

• [1] HIF-1 and NDRG2 contribute to hypoxia-induced radioresistance of cervical cancer Hela cells.Exp Cell Res. 2010 Jul 15;316(12):1985-93. doi: 10.1016/j.yexcr.2010.02.028. Epub 2010 Mar 3.
• [2] NELFE promoted pancreatic cancer metastasis and the epithelialtomesenchymal transition by decreasing the stabilization of NDRG2 mRNA.Int J Oncol. 2019 Dec;55(6):1313-1323. doi: 10.3892/ijo.2019.4890. Epub 2019 Oct 2.
• [3] NDRG2 and TLR7 as novel DNA methylation prognostic signatures for acute myelocytic leukemia.J Cell Physiol. 2020 Apr;235(4):3790-3797. doi: 10.1002/jcp.29273. Epub 2019 Oct 15.
• [4] N-myc downstream-regulated gene 2 (NDRG2) promoter methylation and expression in pituitary adenoma.Diagn Pathol. 2017 Apr 8;12(1):33. doi: 10.1186/s13000-017-0622-7.
• [5] Novel PRMT5-mediated arginine methylations of HSP90A are essential for maintenance of HSP90A function in NDRG2(low) ATL and various cancer cells.Biochim Biophys Acta Mol Cell Res. 2020 Feb;1867(2):118615. doi: 10.1016/j.bbamcr.2019.118615. Epub 2019 Nov 22.
• [6] Combined Aberrant Expression of NDRG2 and LDHA Predicts Hepatocellular Carcinoma Prognosis and Mediates the Anti-tumor Effect of Gemcitabine.Int J Biol Sci. 2019 Jul 3;15(9):1771-1786. doi: 10.7150/ijbs.35094. eCollection 2019.
• [7] N-myc downstream-regulated gene 2 deficiency aggravates memory impairment in Alzheimer's disease.Behav Brain Res. 2020 Feb 3;379:112384. doi: 10.1016/j.bbr.2019.112384. Epub 2019 Nov 25.
• [8] Expression and prognostic value of NDRG2 in human astrocytomas.J Neurol Sci. 2011 Sep 15;308(1-2):77-82. doi: 10.1016/j.jns.2011.06.007. Epub 2011 Jun 25.
• [9] Expression of N-Myc Downstream-Regulated Gene 2 in Bladder Cancer and Its Potential Utility as a Urinary Diagnostic Biomarker.Med Sci Monit. 2017 Sep 27;23:4644-4649. doi: 10.12659/msm.901610.
• [10] NDRG2 promotes adriamycin sensitivity through a Bad/p53 complex at the mitochondria in breast cancer.Oncotarget. 2017 Apr 25;8(17):29038-29047. doi: 10.18632/oncotarget.16035.
• [11] Abundant NDRG2 Expression Is Associated with Aggressiveness and Unfavorable Patients' Outcome in Basal-Like Breast Cancer.PLoS One. 2016 Jul 11;11(7):e0159073. doi: 10.1371/journal.pone.0159073. eCollection 2016.
• [12] Suppression of N-myc downstream-regulated gene 2 is associated with induction of Myc in colorectal cancer and correlates closely with differentiation.Biol Pharm Bull. 2009 Jun;32(6):968-75. doi: 10.1248/bpb.32.968.
• [13] Loss of NDRG2 in liver microenvironment inhibits cancer liver metastasis by regulating tumor associate macrophages polarization.Cell Death Dis. 2018 Feb 14;9(2):248. doi: 10.1038/s41419-018-0284-8.
• [14] Up-regulation of NDRG2 in senescent lens epithelial cells contributes to age-related cataract in human. PLoS One. 2011;6(10):e26102. doi: 10.1371/journal.pone.0026102. Epub 2011 Oct 17.
• [15] Tumor suppressor candidate gene, NDRG2 is frequently inactivated in human glioblastoma multiforme.Mol Med Rep. 2014 Aug;10(2):891-6. doi: 10.3892/mmr.2014.2237. Epub 2014 May 14.
• [16] Global gene expression analysis of rat colon cancers induced by a food-borne carcinogen, 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine.Carcinogenesis. 2004 Aug;25(8):1495-505. doi: 10.1093/carcin/bgh155. Epub 2004 Apr 1.
• [17] Expression of NDRG2 in Human Colorectal Cancer and its Association with Prognosis.J Cancer. 2019 Jun 9;10(15):3373-3380. doi: 10.7150/jca.31382. eCollection 2019.
• [18] Expression of NDRG2 in esophageal squamous cell carcinoma.Cancer Sci. 2010 May;101(5):1292-9. doi: 10.1111/j.1349-7006.2010.01529.x. Epub 2010 Feb 11.
• [19] NDRG2, suppressed expression associates with poor prognosis in pancreatic cancer, is hypermethylated in the second promoter in human gastrointestinal cancers.Biochem Biophys Res Commun. 2017 Feb 26;484(1):138-143. doi: 10.1016/j.bbrc.2017.01.055. Epub 2017 Jan 16.
• [20] Astrocyte-specific NDRG2 gene: functions in the brain and neurological diseases.Cell Mol Life Sci. 2020 Jul;77(13):2461-2472. doi: 10.1007/s00018-019-03406-9. Epub 2019 Dec 13.
• [21] The regulation of NDRG2 expression during ATLL development after HTLV-1 infection.Biochim Biophys Acta Mol Basis Dis. 2019 Oct 1;1865(10):2633-2646. doi: 10.1016/j.bbadis.2019.07.001. Epub 2019 Jul 8.
• [22] Ganoderic acid A/DM-induced NDRG2 over-expression suppresses high-grade meningioma growth.Clin Transl Oncol. 2020 Jul;22(7):1138-1145. doi: 10.1007/s12094-019-02240-6. Epub 2019 Nov 15.
• [23] Low expression of N-myc downstream-regulated gene 2 (NDRG2) correlates with poor prognosis in hepatoblastoma.Hepatol Int. 2016 Mar;10(2):370-6. doi: 10.1007/s12072-015-9686-1. Epub 2015 Dec 8.
• [24] Ndrg2 deficiency ameliorates neurodegeneration in experimental autoimmune encephalomyelitis.J Neurochem. 2018 Apr;145(2):139-153. doi: 10.1111/jnc.14294. Epub 2018 Feb 19.
• [25] Intelectin 1 suppresses the growth, invasion and metastasis of neuroblastoma cells through up-regulation of N-myc downstream regulated gene 2.Mol Cancer. 2015 Feb 21;14:47. doi: 10.1186/s12943-015-0320-6.
• [26] Suppression of microRNA-454 impedes the proliferation and invasion of prostate cancer cells by promoting N-myc downstream-regulated gene 2 and inhibiting WNT/-catenin signaling.Biomed Pharmacother. 2018 Jan;97:120-127. doi: 10.1016/j.biopha.2017.10.115. Epub 2017 Nov 6.
• [27] The tumor suppressor NDRG2 cooperates with an mTORC1 inhibitor to suppress the Warburg effect in renal cell carcinoma.Invest New Drugs. 2020 Aug;38(4):956-966. doi: 10.1007/s10637-019-00839-8. Epub 2019 Aug 28.
• [28] Loss of NDRG2 Expression Confers Oral Squamous Cell Carcinoma with Enhanced Metastatic Potential.Cancer Res. 2017 May 1;77(9):2363-2374. doi: 10.1158/0008-5472.CAN-16-2114. Epub 2017 Feb 16.
• [29] DNA methylation of NDRG2 in gastric cancer and its clinical significance.Dig Dis Sci. 2013 Mar;58(3):715-23. doi: 10.1007/s10620-012-2393-z. Epub 2012 Sep 26.
• [30] Expression profile of the N-myc Downstream Regulated Gene 2 (NDRG2) in human cancers with focus on breast cancer.BMC Cancer. 2011 Jan 12;11:14. doi: 10.1186/1471-2407-11-14.
• [31] Overexpression of NDRG2 Increases Iodine Uptake and Inhibits Thyroid Carcinoma Cell Growth In Situ and In Vivo.Oncol Res. 2016 Jan 21;23(1-2):43-51. doi: 10.3727/096504015X14452563486093.
• [32] NDRG2 and NDRG4 Expression Is Altered in Glioblastoma and Influences Survival in Patients with MGMT-methylated Tumors.Anticancer Res. 2016 Mar;36(3):887-97.
• [33] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [34] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [35] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [36] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [39] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [40] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [41] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [42] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [43] Proteomic analysis of hepatic effects of phenobarbital in mice with humanized liver. Arch Toxicol. 2022 Oct;96(10):2739-2754. doi: 10.1007/s00204-022-03338-7. Epub 2022 Jul 26.
• [44] Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.
• [45] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [46] PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
• [47] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [48] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [49] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [50] Gene expression profile of the nucleus accumbens of human cocaine abusers: evidence for dysregulation of myelin. J Neurochem. 2004 Mar;88(5):1211-9. doi: 10.1046/j.1471-4159.2003.02247.x.
• [51] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [52] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [53] The G Protein-Coupled Estrogen Receptor Agonist G-1 Inhibits Nuclear Estrogen Receptor Activity and Stimulates Novel Phosphoproteomic Signatures. Toxicol Sci. 2016 Jun;151(2):434-46. doi: 10.1093/toxsci/kfw057. Epub 2016 Mar 29.
• [54] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [55] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [56] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [57] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.
• [58] Up-regulation of NDRG2 in senescent lens epithelial cells contributes to age-related cataract in human. PLoS One. 2011;6(10):e26102. doi: 10.1371/journal.pone.0026102. Epub 2011 Oct 17.