Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5MHHOP)

• DOT Name: Fibulin-1 (FBLN1)
• Synonyms: FIBL-1
• Gene Name: FBLN1
• Related Disease:
  Carcinoma
  Epithelial neoplasm
  Gastric neoplasm
  Ovarian cancer
  Acute coronary syndrome
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Cardiac failure
  Cardiovascular disease
  Clear cell renal carcinoma
  Congestive heart failure
  Familial multiple trichoepithelioma
  Gastric cancer
  Hepatocellular carcinoma
  Intrahepatic cholangiocarcinoma
  Leiomyoma
  Neoplasm
  Polyp of large intestine
  Prostate carcinoma
  Prostate neoplasm
  Renal cell carcinoma
  Stomach cancer
  Syndactyly
  Systolic heart failure
  Type-1/2 diabetes
  Urinary bladder cancer
  Urinary bladder neoplasm
  Advanced cancer
  Benign neoplasm
  Bipolar disorder
  Chronic obstructive pulmonary disease
  Colorectal carcinoma
  Cutaneous melanoma
  Fibrosarcoma
  Melanoma
  Meningioma
  Polycystic ovarian syndrome
  FBLN1-related developmental delay-central nervous system anomaly-syndactyly syndrome
  Endometriosis
  Asthma
  Breast neoplasm
  Colon adenocarcinoma
  Colon cancer
  Colon carcinoma
  Metastatic malignant neoplasm
  OPTN-related open angle glaucoma
  Prostate cancer
  Synpolydactyly type 2
• UniProt ID: FBLN1_HUMAN
• Pfam ID: PF01821 ; PF12662 ; PF07645
• Sequence:
  MERAAPSRRVPLPLLLLGGLALLAAGVDADVLLEACCADGHRMATHQKDCSLPYATESKE
  CRMVQEQCCHSQLEELHCATGISLANEQDRCATPHGDNASLEATFVKRCCHCCLLGRAAQ
  AQGQSCEYSLMVGYQCGQVFQACCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRC
  RGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSF
  RCQRDSSCGTGYELTEDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQ
  DALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDEC
  APPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLG
  SYLCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCE
  DIDECALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINE
  TCFNIQGGFRCLAFECPENYRRSAATLQQEKTDTVRCIKSCRPNDVTCVFDPVHTISHTV
  ISLPTFREFTRPEEIIFLRAITPPHPASQANIIFDITEGNLRDSFDIIKRYMDGMTVGVV
  RQVRPIVGPFHAVLKLEMNYVVGGVVSHRNVVNVHIFVSEYWF
• Function: Incorporated into fibronectin-containing matrix fibers. May play a role in cell adhesion and migration along protein fibers within the extracellular matrix (ECM). Could be important for certain developmental processes and contribute to the supramolecular organization of ECM architecture, in particular to those of basement membranes. Has been implicated in a role in cellular transformation and tumor invasion, it appears to be a tumor suppressor. May play a role in haemostasis and thrombosis owing to its ability to bind fibrinogen and incorporate into clots. Could play a significant role in modulating the neurotrophic activities of APP, particularly soluble APP.
• Tissue Specificity: Isoform A and isoform B are only expressed in placenta. Isoform C and isoform D are expressed in a variety of tissues and cultured cells.
• KEGG Pathway: Cytoskeleton in muscle cells (hsa04820)
• Reactome Pathway: Molecules associated with elastic fibres (R-HSA-2129379)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma	DISH9F1N	Definitive	Biomarker	[1]
Epithelial neoplasm	DIS0T594	Definitive	Altered Expression	[1]
Gastric neoplasm	DISOKN4Y	Definitive	Altered Expression	[2]
Ovarian cancer	DISZJHAP	Definitive	Altered Expression	[1]
Acute coronary syndrome	DIS7DYEW	Strong	Biomarker	[3]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[4]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[5]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[5]
Cardiac failure	DISDC067	Strong	Altered Expression	[6]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[7]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[8]
Congestive heart failure	DIS32MEA	Strong	Altered Expression	[6]
Familial multiple trichoepithelioma	DISKZAUY	Strong	Biomarker	[9]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[10]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[11]
Intrahepatic cholangiocarcinoma	DIS6GOC8	Strong	Altered Expression	[12]
Leiomyoma	DISLDDFN	Strong	Altered Expression	[13]
Neoplasm	DISZKGEW	Strong	Biomarker	[14]
Polyp of large intestine	DISRE1MK	Strong	Altered Expression	[14]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[15]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[16]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[8]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[10]
Syndactyly	DISZK2BT	Strong	Genetic Variation	[17]
Systolic heart failure	DISSFU1K	Strong	Biomarker	[6]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[6]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[4]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[4]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[18]
Benign neoplasm	DISDUXAD	moderate	Altered Expression	[19]
Bipolar disorder	DISAM7J2	moderate	Genetic Variation	[20]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Biomarker	[21]
Colorectal carcinoma	DIS5PYL0	moderate	Biomarker	[14]
Cutaneous melanoma	DIS3MMH9	moderate	Posttranslational Modification	[22]
Fibrosarcoma	DISWX7MU	moderate	Biomarker	[19]
Melanoma	DIS1RRCY	moderate	Posttranslational Modification	[22]
Meningioma	DISPT4TG	moderate	Biomarker	[23]
Polycystic ovarian syndrome	DISZ2BNG	moderate	Biomarker	[24]
FBLN1-related developmental delay-central nervous system anomaly-syndactyly syndrome	DISF9JDZ	Supportive	Autosomal recessive	[17]
Endometriosis	DISX1AG8	Disputed	Biomarker	[25]
Asthma	DISW9QNS	Limited	Genetic Variation	[26]
Breast neoplasm	DISNGJLM	Limited	Genetic Variation	[27]
Colon adenocarcinoma	DISDRE0J	Limited	Altered Expression	[28]
Colon cancer	DISVC52G	Limited	Genetic Variation	[28]
Colon carcinoma	DISJYKUO	Limited	Genetic Variation	[28]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[29]
OPTN-related open angle glaucoma	DISDR98A	Limited	Biomarker	[30]
Prostate cancer	DISF190Y	Limited	Biomarker	[15]
Synpolydactyly type 2	DIS5CUOH	Limited	Autosomal recessive	[31]

36 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Fibulin-1 (FBLN1).	[32]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Fibulin-1 (FBLN1).	[33]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Fibulin-1 (FBLN1).	[34]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Fibulin-1 (FBLN1).	[35]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Fibulin-1 (FBLN1).	[36]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Fibulin-1 (FBLN1).	[37]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Fibulin-1 (FBLN1).	[38]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Fibulin-1 (FBLN1).	[39]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Fibulin-1 (FBLN1).	[40]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Fibulin-1 (FBLN1).	[41]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Fibulin-1 (FBLN1).	[42]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Fibulin-1 (FBLN1).	[43]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Fibulin-1 (FBLN1).	[44]
Selenium	DM25CGV	Approved	Selenium increases the expression of Fibulin-1 (FBLN1).	[45]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Fibulin-1 (FBLN1).	[46]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Fibulin-1 (FBLN1).	[40]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Fibulin-1 (FBLN1).	[47]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Fibulin-1 (FBLN1).	[49]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Fibulin-1 (FBLN1).	[43]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Fibulin-1 (FBLN1).	[50]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Fibulin-1 (FBLN1).	[51]
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of Fibulin-1 (FBLN1).	[52]
Mifepristone	DMGZQEF	Approved	Mifepristone decreases the expression of Fibulin-1 (FBLN1).	[53]
Pioglitazone	DMKJ485	Approved	Pioglitazone increases the expression of Fibulin-1 (FBLN1).	[54]
Prednisolone	DMQ8FR2	Approved	Prednisolone increases the expression of Fibulin-1 (FBLN1).	[43]
Vitamin C	DMXJ7O8	Approved	Vitamin C increases the expression of Fibulin-1 (FBLN1).	[39]
Sodium phenylbutyrate	DMXLBCQ	Approved	Sodium phenylbutyrate increases the expression of Fibulin-1 (FBLN1).	[55]
Methylprednisolone	DM4BDON	Approved	Methylprednisolone increases the expression of Fibulin-1 (FBLN1).	[43]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Fibulin-1 (FBLN1).	[36]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Fibulin-1 (FBLN1).	[45]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Fibulin-1 (FBLN1).	[56]
GSK2110183	DMZHB37	Phase 2	GSK2110183 increases the expression of Fibulin-1 (FBLN1).	[57]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Fibulin-1 (FBLN1).	[58]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Fibulin-1 (FBLN1).	[60]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Fibulin-1 (FBLN1).	[61]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone decreases the expression of Fibulin-1 (FBLN1).	[62]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Fibulin-1 (FBLN1).	[48]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Fibulin-1 (FBLN1).	[59]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Fibulin-1 (FBLN1).	[48]

References

• [1] Increased immunostaining of fibulin-1, an estrogen-regulated protein in the stroma of human ovarian epithelial tumors.Am J Pathol. 1998 Nov;153(5):1579-88. doi: 10.1016/S0002-9440(10)65746-X.
• [2] Fibulin 1 is downregulated through promoter hypermethylation in gastric cancer.Br J Cancer. 2008 Dec 16;99(12):2083-7. doi: 10.1038/sj.bjc.6604760. Epub 2008 Nov 4.
• [3] Fibulin? and fibulin? as ruleout tests for non-STelevation myocardial infarction in the emergency setting.Kardiol Pol. 2019 Dec 19;77(12):1170-1175. doi: 10.33963/KP.15041. Epub 2019 Oct 30.
• [4] Fibulin-1 is epigenetically down-regulated and related with bladder cancer recurrence.BMC Cancer. 2014 Sep 18;14:677. doi: 10.1186/1471-2407-14-677.
• [5] Fibulin-1 interacts with Sex Hormone Binding Globulin and is linked to less aggressive estrogen-dependent breast cancers.Life Sci. 2018 Aug 15;207:372-380. doi: 10.1016/j.lfs.2018.06.024. Epub 2018 Jun 22.
• [6] Galectin-3 and fibulin-1 in systolic heart failure - relation to glucose metabolism and left ventricular contractile reserve.BMC Cardiovasc Disord. 2017 Jan 10;17(1):22. doi: 10.1186/s12872-016-0437-6.
• [7] Fibulins and their role in cardiovascular biology and disease.Adv Clin Chem. 2014;67:245-65. doi: 10.1016/bs.acc.2014.09.008. Epub 2014 Nov 4.
• [8] Fibulin-1 is down-regulated through promoter hypermethylation and suppresses renal cell carcinoma progression.J Urol. 2013 Jul;190(1):291-301. doi: 10.1016/j.juro.2013.01.098. Epub 2013 Feb 4.
• [9] RNA sequencing of esophageal adenocarcinomas identifies novel fusion transcripts, including NPC1-MELK, arising from a complex chromosomal rearrangement.Cancer. 2017 Oct 15;123(20):3916-3924. doi: 10.1002/cncr.30837. Epub 2017 Jun 22.
• [10] Low expression of fibulin-1 correlates with unfavorable prognosis in gastric cancer.Tumour Biol. 2016 Jul;37(7):9399-410. doi: 10.1007/s13277-015-4537-1. Epub 2016 Jan 16.
• [11] Targeted deep sequencing of plasma circulating cell-free DNA reveals Vimentin and Fibulin 1 as potential epigenetic biomarkers for hepatocellular carcinoma.PLoS One. 2017 Mar 23;12(3):e0174265. doi: 10.1371/journal.pone.0174265. eCollection 2017.
• [12] The clinical value of Fibulin-1 for prognosis and its prospective mechanism in intrahepatic cholangiocarcinoma.HPB (Oxford). 2019 Apr;21(4):499-507. doi: 10.1016/j.hpb.2018.09.002. Epub 2018 Sep 26.
• [13] CCNs, fibulin-1C and S100A4 expression in leiomyoma and myometrium: inverse association with TGF-beta and regulation by TGF-beta in leiomyoma and myometrial smooth muscle cells.Mol Hum Reprod. 2006 Apr;12(4):245-56. doi: 10.1093/molehr/gal015. Epub 2006 Mar 29.
• [14] Serum FBLN1 and STK31 as biomarkers of colorectal cancer and their ability to noninvasively differentiate colorectal cancer from benign polyps.Clin Chim Acta. 2018 Aug;483:151-155. doi: 10.1016/j.cca.2018.04.038. Epub 2018 Apr 30.
• [15] Identification of Fibulin-1 as a Human Bone Marrow Stromal (HS-5) Cell-Derived Factor That Induces Human Prostate Cancer Cell Death.Prostate. 2017 May;77(7):729-742. doi: 10.1002/pros.23303. Epub 2017 Feb 7.
• [16] Downregulation of several fibulin genes in prostate cancer.Prostate. 2007 Dec 1;67(16):1770-80. doi: 10.1002/pros.20667.
• [17] Mutation of fibulin-1 causes a novel syndrome involving the central nervous system and connective tissues. Eur J Hum Genet. 2014 May;22(5):640-3. doi: 10.1038/ejhg.2013.210. Epub 2013 Oct 2.
• [18] Fibulin-1 is downregulated through promoter hypermethylation in colorectal cancer: a CONSORT study.Medicine (Baltimore). 2015 Apr;94(13):e663. doi: 10.1097/MD.0000000000000663.
• [19] Elevated expression and altered processing of fibulin-1 protein in human breast cancer.Br J Cancer. 2003 Mar 24;88(6):871-8. doi: 10.1038/sj.bjc.6600802.
• [20] Genome-wide association study of temperament in bipolar disorder reveals significant associations with three novel Loci.Biol Psychiatry. 2012 Aug 15;72(4):303-10. doi: 10.1016/j.biopsych.2012.01.018. Epub 2012 Feb 23.
• [21] Differential regulation of extracellular matrix and soluble fibulin-1 levels by TGF-?in airway smooth muscle cells.PLoS One. 2013 Jun 7;8(6):e65544. doi: 10.1371/journal.pone.0065544. Print 2013.
• [22] Abnormal hypermethylation and clinicopathological significance of FBLN1 gene in cutaneous melanoma.Tumour Biol. 2014 Jan;35(1):123-7. doi: 10.1007/s13277-013-1015-5. Epub 2013 Aug 2.
• [23] Microarray gene expression profiling in meningiomas: differential expression according to grade or histopathological subtype.Int J Oncol. 2009 Dec;35(6):1395-407. doi: 10.3892/ijo_00000457.
• [24] Increased fibulin-1 plasma levels in polycystic ovary syndrome (PCOS) patients: possible contribution to the link between PCOS and cardiovascular risk.J Endocrinol Invest. 2019 Jan;42(1):91-96. doi: 10.1007/s40618-018-0891-3. Epub 2018 Apr 21.
• [25] Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
• [26] Airway remodelling and inflammation in asthma are dependent on the extracellular matrix protein fibulin-1c.J Pathol. 2017 Dec;243(4):510-523. doi: 10.1002/path.4979.
• [27] Transcriptional and posttranscriptional regulation of fibulin-1 by estrogens leads to differential induction of messenger ribonucleic acid variants in ovarian and breast cancer cells.Endocrinology. 2005 Feb;146(2):760-8. doi: 10.1210/en.2004-1239. Epub 2004 Nov 4.
• [28] GROalpha is highly expressed in adenocarcinoma of the colon and down-regulates fibulin-1.Clin Cancer Res. 2006 Oct 15;12(20 Pt 1):5951-9. doi: 10.1158/1078-0432.CCR-06-0736.
• [29] Calumenin and fibulin-1 on tumor metastasis: Implications for pharmacology.Pharmacol Res. 2015 Sep;99:11-5. doi: 10.1016/j.phrs.2015.05.001. Epub 2015 May 12.
• [30] Differential global and extra-cellular matrix focused gene expression patterns between normal and glaucomatous human lamina cribrosa cells.Mol Vis. 2009;15:76-88. Epub 2009 Jan 15.
• [31] Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
• [32] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [33] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [34] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [35] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [36] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [37] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [38] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [39] Synergistic effects of arsenic trioxide combined with ascorbic acid in human osteosarcoma MG-63 cells: a systems biology analysis. Eur Rev Med Pharmacol Sci. 2014;18(24):3877-88.
• [40] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [41] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [42] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [43] Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
• [44] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [45] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [46] Progesterone induces the fibulin-1 expression in human endometrial stromal cells. Hum Reprod. 2005 Jun;20(6):1447-55. doi: 10.1093/humrep/deh841. Epub 2005 Mar 17.
• [47] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [48] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [49] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [50] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [51] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [52] Differential regulation of the p73 cistrome by mammalian target of rapamycin reveals transcriptional programs of mesenchymal differentiation and tumorigenesis. Proc Natl Acad Sci U S A. 2011 Feb 1;108(5):2076-81. doi: 10.1073/pnas.1011936108. Epub 2011 Jan 18.
• [53] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [54] Peroxisome proliferator activated receptor gamma (PPAR-gama) ligand pioglitazone regulated gene networks in term human primary trophoblast cells. Reprod Toxicol. 2018 Oct;81:99-107.
• [55] Gene expression profile analysis of 4-phenylbutyrate treatment of IB3-1 bronchial epithelial cell line demonstrates a major influence on heat-shock proteins. Physiol Genomics. 2004 Jan 15;16(2):204-11.
• [56] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [57] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [58] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [59] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [60] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [61] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [62] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.