Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6UYT3X)

• DOT Name: Microtubule-associated protein 2 (MAP2)
• Synonyms: MAP-2
• Gene Name: MAP2
• Related Disease:
  Hyperglycemia
  Subarachnoid hemorrhage
  Adult glioblastoma
  Age-related macular degeneration
  Alzheimer disease
  Amyloidosis
  Bipolar disorder
  Breast cancer
  Breast carcinoma
  Cerebral infarction
  Dementia
  Endometriosis
  Glioblastoma multiforme
  Glioma
  Huntington disease
  Hypothyroidism
  Juvenile idiopathic arthritis
  Leiomyoma
  Lewy body dementia
  Major depressive disorder
  Mantle cell lymphoma
  Medulloblastoma
  Melanocytic nevus
  Parkinson disease
  Sciatic neuropathy
  Squamous cell carcinoma
  Status epilepticus seizure
  Temporal lobe epilepsy
  Uterine fibroids
  Amyotrophic lateral sclerosis
  Cutaneous melanoma
  Pancreatic cancer
  Malaria
  Autism
  Cervical cancer
  Cervical carcinoma
  Melanoma
  Metastatic melanoma
  Mood disorder
  Multiple sclerosis
  Neuroblastoma
  Stroke
  Type-1/2 diabetes
• UniProt ID: MTAP2_HUMAN
• Pfam ID: PF08377 ; PF00418
• Sequence:
  MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGE
  HGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQT
  AALPLAAEETANLPPSPPPSPASEQTVTVEEDLLTASKMEFHDQQELTPSTAEPSDQKEK
  ESEKQSKPGEDLKHAALVSQPETTKTYPDKKDMQGTEEEKAPLALFGHTLVASLEDMKQK
  TEPSLVVPGIDLPKEPPTPKEQKDWFIEMPTEAKKDEWGLVAPISPGPLTPMREKDVFDD
  IPKWEGKQFDSPMPSPFQGGSFTLPLDVMKNEIVTETSPFAPAFLQPDDKKSLQQTSGPA
  TAKDSFKIEEPHEAKPDKMAEAPPSEAMTLPKDAHIPVVEEHVMGKVLEEEKEAINQETV
  QQRDTFTPSGQEPILTEKETELKLEEKTTISDKEAVPKESKPPKPADEEIGIIQTSTEHT
  FSEQKDQEPTTDMLKQDSFPVSLEQAVTDSAMTSKTLEKAMTEPSALIEKSSIQELFEMR
  VDDKDKIEGVGAATSAELDMPFYEDKSGMSKYFETSALKEEATKSIEPGSDYYELSDTRE
  SVHESIDTMSPMHKNGDKEFQTGKESQPSPPAQEAGYSTLAQSYPSDLPEEPSSPQERMF
  TIDPKVYGEKRDLHSKNKDDLTLSRSLGLGGRSAIEQRSMSINLPMSCLDSIALGFNFGR
  GHDLSPLASDILTNTSGSMDEGDDYLPATTPALEKAPCFPVESKEEEQIEKVKATGEEST
  QAEISCESPFLAKDFYKNGTVMAPDLPEMLDLAGTRSRLASVSADAEVARRKSVPSETVV
  EDSRTGLPPVTDENHVIVKTDSQLEDLGYCVFNKYTVPLPSPVQDSENLSGESGTFYEGT
  DDKVRRDLATDLSLIEVKLAAAGRVKDEFSVDKEASAHISGDKSGLSKEFDQEKKANDRL
  DTVLEKSEEHADSKEHAKKTEEAGDEIETFGLGVTYEQALAKDLSIPTDASSEKAEKGLS
  SVPEIAEVEPSKKVEQGLDFAVQGQLDVKISDFGQMASGLNIDDRRATELKLEATQDMTP
  SSKAPQEADAFMGVESGHMKEGTKVSETEVKEKVAKPDLVHQEAVDKEESYESSGEHESL
  TMESLKADEGKKETSPESSLIQDEIAVKLSVEIPCPPAVSEADLATDERADVQMEFIQGP
  KEESKETPDISITPSDVAEPLHETIVSEPAEIQSEEEEIEAQGEYDKLLFRSDTLQITDL
  GVSGAREEFVETCPSEHKGVIESVVTIEDDFITVVQTTTDEGESGSHSVRFAALEQPEVE
  RRPSPHDEEEFEVEEAAEAQAEPKDGSPEAPASPEREEVALSEYKTETYDDYKDETTIDD
  SIMDADSLWVDTQDDDRSIMTEQLETIPKEEKAEKEARRSSLEKHRKEKPFKTGRGRIST
  PERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKTEVQAHSPSRKFILKPAIKYTRPTHLS
  CVKRKTTAAGGESALAPSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDE
  NSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTP
  SYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGST
  DNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKV
  GSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSS
  GSINLLESPQLATLAEDVTAALAKQGL
• Function: The exact function of MAP2 is unknown but MAPs may stabilize the microtubules against depolymerization. They also seem to have a stiffening effect on microtubules.

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hyperglycemia	DIS0BZB5	Definitive	Biomarker	[1]
Subarachnoid hemorrhage	DISI7I8Y	Definitive	Biomarker	[2]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[3]
Age-related macular degeneration	DIS0XS2C	Strong	Genetic Variation	[4]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[5]
Amyloidosis	DISHTAI2	Strong	Altered Expression	[6]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[7]
Breast cancer	DIS7DPX1	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[8]
Cerebral infarction	DISR1WNP	Strong	Biomarker	[9]
Dementia	DISXL1WY	Strong	Biomarker	[10]
Endometriosis	DISX1AG8	Strong	Altered Expression	[11]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[3]
Glioma	DIS5RPEH	Strong	Altered Expression	[12]
Huntington disease	DISQPLA4	Strong	Altered Expression	[13]
Hypothyroidism	DISR0H6D	Strong	Biomarker	[14]
Juvenile idiopathic arthritis	DISQZGBV	Strong	Biomarker	[15]
Leiomyoma	DISLDDFN	Strong	Altered Expression	[16]
Lewy body dementia	DISAE66J	Strong	Biomarker	[17]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[7]
Mantle cell lymphoma	DISFREOV	Strong	Biomarker	[18]
Medulloblastoma	DISZD2ZL	Strong	Biomarker	[19]
Melanocytic nevus	DISYS32D	Strong	Altered Expression	[20]
Parkinson disease	DISQVHKL	Strong	Biomarker	[17]
Sciatic neuropathy	DISMGDKX	Strong	Biomarker	[21]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[22]
Status epilepticus seizure	DISY3BIC	Strong	Biomarker	[23]
Temporal lobe epilepsy	DISNOPXX	Strong	Biomarker	[24]
Uterine fibroids	DISBZRMJ	Strong	Altered Expression	[16]
Amyotrophic lateral sclerosis	DISF7HVM	moderate	Biomarker	[25]
Cutaneous melanoma	DIS3MMH9	moderate	Altered Expression	[26]
Pancreatic cancer	DISJC981	moderate	Genetic Variation	[27]
Malaria	DISQ9Y50	Disputed	Biomarker	[28]
Autism	DISV4V1Z	Limited	Genetic Variation	[29]
Cervical cancer	DISFSHPF	Limited	Biomarker	[30]
Cervical carcinoma	DIST4S00	Limited	Biomarker	[30]
Melanoma	DIS1RRCY	Limited	Altered Expression	[31]
Metastatic melanoma	DISSL43L	Limited	Biomarker	[20]
Mood disorder	DISLVMWO	Limited	Biomarker	[32]
Multiple sclerosis	DISB2WZI	Limited	Altered Expression	[33]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[34]
Stroke	DISX6UHX	Limited	Biomarker	[35]
Type-1/2 diabetes	DISIUHAP	Limited	Altered Expression	[36]

35 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Microtubule-associated protein 2 (MAP2).	[37]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Microtubule-associated protein 2 (MAP2).	[38]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Microtubule-associated protein 2 (MAP2).	[39]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Microtubule-associated protein 2 (MAP2).	[40]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Microtubule-associated protein 2 (MAP2).	[41]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Microtubule-associated protein 2 (MAP2).	[42]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Microtubule-associated protein 2 (MAP2).	[43]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Microtubule-associated protein 2 (MAP2).	[45]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Microtubule-associated protein 2 (MAP2).	[46]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Microtubule-associated protein 2 (MAP2).	[47]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Microtubule-associated protein 2 (MAP2).	[48]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Microtubule-associated protein 2 (MAP2).	[49]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Microtubule-associated protein 2 (MAP2).	[50]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Microtubule-associated protein 2 (MAP2).	[51]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Microtubule-associated protein 2 (MAP2).	[52]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Microtubule-associated protein 2 (MAP2).	[53]
Capsaicin	DMGMF6V	Approved	Capsaicin increases the expression of Microtubule-associated protein 2 (MAP2).	[54]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of Microtubule-associated protein 2 (MAP2).	[55]
Colchicine	DM2POTE	Approved	Colchicine decreases the expression of Microtubule-associated protein 2 (MAP2).	[56]
Enzalutamide	DMGL19D	Approved	Enzalutamide decreases the expression of Microtubule-associated protein 2 (MAP2).	[57]
Scopolamine	DMOM8AL	Approved	Scopolamine decreases the expression of Microtubule-associated protein 2 (MAP2).	[58]
Amantadine	DMS3YE9	Approved	Amantadine decreases the expression of Microtubule-associated protein 2 (MAP2).	[56]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Microtubule-associated protein 2 (MAP2).	[57]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Microtubule-associated protein 2 (MAP2).	[60]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Microtubule-associated protein 2 (MAP2).	[61]
UNC0379	DMD1E4J	Preclinical	UNC0379 increases the expression of Microtubule-associated protein 2 (MAP2).	[62]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Microtubule-associated protein 2 (MAP2).	[64]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Microtubule-associated protein 2 (MAP2).	[65]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Microtubule-associated protein 2 (MAP2).	[66]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Microtubule-associated protein 2 (MAP2).	[67]
Glyphosate	DM0AFY7	Investigative	Glyphosate increases the expression of Microtubule-associated protein 2 (MAP2).	[68]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Microtubule-associated protein 2 (MAP2).	[69]
methylglyoxal	DMRC3OZ	Investigative	methylglyoxal decreases the expression of Microtubule-associated protein 2 (MAP2).	[70]
ORG2058	DMH1M6N	Investigative	ORG2058 increases the expression of Microtubule-associated protein 2 (MAP2).	[71]
tryptanthrin	DMTRYCI	Investigative	tryptanthrin increases the expression of Microtubule-associated protein 2 (MAP2).	[72]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Microtubule-associated protein 2 (MAP2).	[44]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Microtubule-associated protein 2 (MAP2).	[59]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Microtubule-associated protein 2 (MAP2).	[63]

References

• [1] Neonatal hyperglycemia alters the neurochemical profile, dendritic arborization and gene expression in the developing rat hippocampus.NMR Biomed. 2018 May;31(5):e3910. doi: 10.1002/nbm.3910. Epub 2018 Mar 13.
• [2] Morphological Characteristics of Neuronal Death After Experimental Subarachnoid Hemorrhage in Mice Using Double Immunoenzymatic Technique.J Histochem Cytochem. 2019 Dec;67(12):919-930. doi: 10.1369/0022155419878181. Epub 2019 Sep 17.
• [3] Prolactin increases expression of cytoskeletal proteins in SK-N-SH cells.Folia Biol (Praha). 2014;60(6):281-5.
• [4] The NEI/NCBI dbGAP database: genotypes and haplotypes that may specifically predispose to risk of neovascular age-related macular degeneration.BMC Med Genet. 2008 Jun 9;9:51. doi: 10.1186/1471-2350-9-51.
• [5] Stem Cell-Derived Neurons as Cellular Models of Sporadic Alzheimer's Disease.J Alzheimers Dis. 2019;67(3):893-910. doi: 10.3233/JAD-180833.
• [6] Catalpol protects synaptic proteins from beta-amyloid induced neuron injury and improves cognitive functions in aged rats.Oncotarget. 2017 May 17;8(41):69303-69315. doi: 10.18632/oncotarget.17951. eCollection 2017 Sep 19.
• [7] Reduced spinophilin but not microtubule-associated protein 2 expression in the hippocampal formation in schizophrenia and mood disorders: molecular evidence for a pathology of dendritic spines.Am J Psychiatry. 2004 Oct;161(10):1848-55. doi: 10.1176/ajp.161.10.1848.
• [8] Identification of markers of taxane sensitivity using proteomic and genomic analyses of breast tumors from patients receiving neoadjuvant paclitaxel and radiation.Clin Cancer Res. 2010 Jan 15;16(2):681-90. doi: 10.1158/1078-0432.CCR-09-1091. Epub 2010 Jan 12.
• [9] Neuroprotective effect of Convolvulus pluricaulis Choisy in oxidative stress model of cerebral ischemia reperfusion injury and assessment of MAP2 in rats.J Ethnopharmacol. 2020 Mar 1;249:112393. doi: 10.1016/j.jep.2019.112393. Epub 2019 Nov 16.
• [10] Progressive signaling changes in the olfactory nerve of patients with Alzheimer's disease.Neurobiol Aging. 2019 Apr;76:80-95. doi: 10.1016/j.neurobiolaging.2018.12.006. Epub 2018 Dec 27.
• [11] Expression of microtubule associated protein 2 and synaptophysin in endometrium: high levels in deep infiltrating endometriosis lesions.Fertil Steril. 2016 Feb;105(2):435-43. doi: 10.1016/j.fertnstert.2015.10.024. Epub 2015 Nov 18.
• [12] Microtubule-associated protein 2 knockdown sensitizes glioma cells to vincristine treatment.Neuroreport. 2020 Feb 5;31(3):197-204. doi: 10.1097/WNR.0000000000001378.
• [13] MAP2 Splicing is Altered in Huntington's Disease.Brain Pathol. 2017 Mar;27(2):181-189. doi: 10.1111/bpa.12387. Epub 2016 Jul 7.
• [14] Royal jelly increased map-2 expression in hippocampal neurons of hypothyroid rats: an immunohistochemical study.Biotech Histochem. 2020 Jan;95(1):46-54. doi: 10.1080/10520295.2019.1632486. Epub 2019 Sep 11.
• [15] Gene expression signatures in polyarticular juvenile idiopathic arthritis demonstrate disease heterogeneity and offer a molecular classification of disease subsets.Arthritis Rheum. 2009 Jul;60(7):2113-23. doi: 10.1002/art.24534.
• [16] Increased expression of neurogenic factors in uterine fibroids.Hum Reprod. 2019 Nov 1;34(11):2153-2162. doi: 10.1093/humrep/dez182.
• [17] The PPARGC1A locus and CNS-specific PGC-1 isoforms are associated with Parkinson's Disease.Neurobiol Dis. 2019 Jan;121:34-46. doi: 10.1016/j.nbd.2018.09.016. Epub 2018 Sep 17.
• [18] GeneChip analyses point to novel pathogenetic mechanisms in mantle cell lymphoma.Br J Haematol. 2009 Feb;144(3):317-31. doi: 10.1111/j.1365-2141.2008.07443.x. Epub 2008 Nov 7.
• [19] SPARC stimulates neuronal differentiation of medulloblastoma cells via the Notch1/STAT3 pathway.Cancer Res. 2011 Jul 15;71(14):4908-19. doi: 10.1158/0008-5472.CAN-10-3395. Epub 2011 May 25.
• [20] Increased expression of MAP2 inhibits melanoma cell proliferation, invasion and tumor growth in vitro and in vivo.Exp Dermatol. 2010 Nov;19(11):958-64. doi: 10.1111/j.1600-0625.2009.01020.x.
• [21] Expression changes of parvalbumin and microtubule-associated protein 2 induced by chronic constriction injury in rat dorsal root ganglia.Chin Med J (Engl). 2011 Jul;124(14):2184-90.
• [22] Specific induction of the high-molecular-weight microtubule-associated protein 2 (hmw-MAP2) by betel quid extract in cultured oral keratinocytes: clinical implications in betel quid-associated oral squamous cell carcinoma (OSCC).Carcinogenesis. 2004 Feb;25(2):269-76. doi: 10.1093/carcin/bgh006. Epub 2003 Nov 6.
• [23] The expression of G protein-coupled receptor kinase 5 and its interaction with dendritic marker microtubule-associated protein-2 after status epilepticus.Epilepsy Res. 2017 Dec;138:62-70. doi: 10.1016/j.eplepsyres.2017.10.011. Epub 2017 Oct 13.
• [24] BACE1 elevation is associated with aberrant limbic axonal sprouting in epileptic CD1 mice.Exp Neurol. 2012 May;235(1):228-37. doi: 10.1016/j.expneurol.2012.01.003. Epub 2012 Jan 11.
• [25] Proteomics in cerebrospinal fluid and spinal cord suggests UCHL1, MAP2 and GPNMB as biomarkers and underpins importance of transcriptional pathways in amyotrophic lateral sclerosis.Acta Neuropathol. 2020 Jan;139(1):119-134. doi: 10.1007/s00401-019-02093-x. Epub 2019 Nov 7.
• [26] Transcriptional regulation of human MAP2 gene in melanoma: role of neuronal bHLH factors and Notch1 signaling.Nucleic Acids Res. 2006 Aug 11;34(13):3819-32. doi: 10.1093/nar/gkl476. Print 2006.
• [27] Genetic variants in the liver kinase B1-AMP-activated protein kinase pathway genes and pancreatic cancer risk.Mol Carcinog. 2019 Aug;58(8):1338-1348. doi: 10.1002/mc.23018. Epub 2019 Apr 17.
• [28] Functional characterization of both MAP kinases of the human malaria parasite Plasmodium falciparum by reverse genetics.Mol Microbiol. 2007 Sep;65(5):1170-80. doi: 10.1111/j.1365-2958.2007.05859.x. Epub 2007 Jul 26.
• [29] Chromosome 2 deletion encompassing the MAP2 gene in a patient with autism and Rett-like features.Clin Genet. 2003 Dec;64(6):497-501. doi: 10.1046/j.1399-0004.2003.00176.x.
• [30] Molecular analysis of cellular loci disrupted by papillomavirus 16 integration in cervical cancer: frequent viral integration in topologically destabilized and transcriptionally active chromosomal regions.J Med Virol. 1996 May;49(1):15-22. doi: 10.1002/(SICI)1096-9071(199605)49:1<15::AID-JMV3>3.0.CO;2-N.
• [31] Oncogenic BRAFV600E induces expression of neuronal differentiation marker MAP2 in melanoma cells by promoter demethylation and down-regulation of transcription repressor HES1.J Biol Chem. 2010 Jan 1;285(1):242-54. doi: 10.1074/jbc.M109.068668. Epub 2009 Oct 30.
• [32] Microtubule associated protein 2 in bipolar depression: Impact of pregnenolone.J Affect Disord. 2017 Aug 15;218:49-52. doi: 10.1016/j.jad.2017.04.024. Epub 2017 Apr 19.
• [33] A novel microtubule-associated protein-2 expressed in oligodendrocytes in multiple sclerosis lesions.J Neurochem. 1999 Dec;73(6):2531-7. doi: 10.1046/j.1471-4159.1999.0732531.x.
• [34] Overexpression of tissue-nonspecific alkaline phosphatase increases the expression of neurogenic differentiation markers in the human SH-SY5Y neuroblastoma cell line.Bone. 2015 Oct;79:150-61. doi: 10.1016/j.bone.2015.05.033. Epub 2015 May 29.
• [35] NSI-189, a small molecule with neurogenic properties, exerts behavioral, and neurostructural benefits in stroke rats.J Cell Physiol. 2017 Oct;232(10):2731-2740. doi: 10.1002/jcp.25847. Epub 2017 Apr 25.
• [36] The Histamine H1 Receptor Participates in the Increased Dorsal Telencephalic Neurogenesis in Embryos from Diabetic Rats.Front Neurosci. 2017 Dec 14;11:676. doi: 10.3389/fnins.2017.00676. eCollection 2017.
• [37] Neuronal and cardiac toxicity of pharmacological compounds identified through transcriptomic analysis of human pluripotent stem cell-derived embryoid bodies. Toxicol Appl Pharmacol. 2021 Dec 15;433:115792. doi: 10.1016/j.taap.2021.115792. Epub 2021 Nov 3.
• [38] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [39] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [40] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [41] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [42] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [43] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [44] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [45] Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
• [46] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [47] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [48] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [49] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [50] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [51] Pharmacogenomic identification of novel determinants of response to chemotherapy in colon cancer. Cancer Res. 2006 Mar 1;66(5):2765-77.
• [52] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [53] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [54] Capsaicin induces apoptosis and terminal differentiation in human glioma A172 cells. Life Sci. 2008 May 7;82(19-20):997-1003. doi: 10.1016/j.lfs.2008.02.020. Epub 2008 Mar 10.
• [55] Effects of all-trans and 9-cis retinoic acid on differentiating human neural stem cells in vitro. Toxicology. 2023 Mar 15;487:153461. doi: 10.1016/j.tox.2023.153461. Epub 2023 Feb 16.
• [56] Establishment of a 13 genes-based molecular prediction score model to discriminate the neurotoxic potential of food relevant-chemicals. Toxicol Lett. 2022 Feb 1;355:1-18. doi: 10.1016/j.toxlet.2021.10.013. Epub 2021 Nov 5.
• [57] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [58] Protective role of Ashwagandha leaf extract and its component withanone on scopolamine-induced changes in the brain and brain-derived cells. PLoS One. 2011;6(11):e27265. doi: 10.1371/journal.pone.0027265. Epub 2011 Nov 11.
• [59] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [60] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [61] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [62] Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
• [63] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [64] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [65] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [66] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [67] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [68] Glyphosate-based herbicide induces long-lasting impairment in neuronal and glial differentiation. Environ Toxicol. 2022 Aug;37(8):2044-2057. doi: 10.1002/tox.23549. Epub 2022 Apr 29.
• [69] Phenolic-rich extract of avocado Persea americana (var. Colinred) peel blunts paraquat/maneb-induced apoptosis through blocking phosphorylation of LRRK2 kinase in human nerve-like cells. Environ Toxicol. 2022 Mar;37(3):660-676. doi: 10.1002/tox.23433. Epub 2021 Dec 12.
• [70] Methylglyoxal-induced neurotoxic effects in primary neuronal-like cells transdifferentiated from human mesenchymal stem cells: Impact of low concentrations. J Appl Toxicol. 2023 Dec;43(12):1819-1839. doi: 10.1002/jat.4515. Epub 2023 Jul 10.
• [71] The antiproliferative effects of progestins in T47D breast cancer cells are tempered by progestin induction of the ETS transcription factor Elf5. Mol Endocrinol. 2010 Jul;24(7):1380-92. doi: 10.1210/me.2009-0516. Epub 2010 Jun 2.
• [72] Tryptanthrin induces growth inhibition and neuronal differentiation in the human neuroblastoma LA-N-1 cells. Chem Biol Interact. 2013 Apr 25;203(2):512-21. doi: 10.1016/j.cbi.2013.03.001. Epub 2013 Mar 13.