Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT71MN9S)

• DOT Name: Claudin-3 (CLDN3)
• Synonyms: Clostridium perfringens enterotoxin receptor 2; CPE-R 2; CPE-receptor 2; Rat ventral prostate.1 protein homolog; hRVP1
• Gene Name: CLDN3
• Related Disease:
  Liver cirrhosis
  Lung adenocarcinoma
  Advanced cancer
  Atopic dermatitis
  Benign prostatic hyperplasia
  Breast neoplasm
  Carcinoma
  Coeliac disease
  Colitis
  Colon cancer
  Colon carcinoma
  Colorectal neoplasm
  Endometrial cancer
  Endometrial carcinoma
  Endometriosis
  Epithelial neoplasm
  Epithelial ovarian cancer
  Gastric adenocarcinoma
  Gastric cancer
  Hepatitis A virus infection
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Lung squamous cell carcinoma
  Metastatic malignant neoplasm
  Metastatic prostate carcinoma
  Multiple sclerosis
  Neoplasm
  Nervous system inflammation
  Ovarian cancer
  Ovarian neoplasm
  Peptic esophagitis
  Prostate neoplasm
  Psoriasis
  Skin disease
  Colorectal carcinoma
  Gastric neoplasm
  Breast cancer
  Breast carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Hereditary diffuse gastric adenocarcinoma
  Invasive breast carcinoma
  Liver cancer
  Malignant pleural mesothelioma
  Mesothelioma
  Sickle-cell anaemia
  Subarachnoid hemorrhage
  Triple negative breast cancer
• UniProt ID: CLD3_HUMAN
• Pfam ID: PF00822
• Sequence:
  MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQ
  MQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA
  GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALL
  CCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV
• Function: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
• KEGG Pathway:
  Cell adhesion molecules (hsa04514)
  Tight junction (hsa04530)
  Leukocyte transendothelial migration (hsa04670)
  Pathogenic Escherichia coli infection (hsa05130)
  Hepatitis C (hsa05160)
• Reactome Pathway: Tight junction interactions (R-HSA-420029)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Liver cirrhosis	DIS4G1GX	Definitive	Altered Expression	[1]
Lung adenocarcinoma	DISD51WR	Definitive	Genetic Variation	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Atopic dermatitis	DISTCP41	Strong	Altered Expression	[4]
Benign prostatic hyperplasia	DISI3CW2	Strong	Altered Expression	[5]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[6]
Carcinoma	DISH9F1N	Strong	Altered Expression	[7]
Coeliac disease	DISIY60C	Strong	Altered Expression	[8]
Colitis	DISAF7DD	Strong	Altered Expression	[9]
Colon cancer	DISVC52G	Strong	Biomarker	[3]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[3]
Colorectal neoplasm	DISR1UCN	Strong	Altered Expression	[10]
Endometrial cancer	DISW0LMR	Strong	Biomarker	[11]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[11]
Endometriosis	DISX1AG8	Strong	Altered Expression	[12]
Epithelial neoplasm	DIS0T594	Strong	Altered Expression	[13]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[14]
Gastric adenocarcinoma	DISWWLTC	Strong	Posttranslational Modification	[15]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[16]
Hepatitis A virus infection	DISUMFQV	Strong	Biomarker	[17]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[1]
Lung cancer	DISCM4YA	Strong	Biomarker	[18]
Lung carcinoma	DISTR26C	Strong	Biomarker	[18]
Lung squamous cell carcinoma	DISXPIBD	Strong	Altered Expression	[18]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[19]
Metastatic prostate carcinoma	DISVBEZ9	Strong	Altered Expression	[5]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[20]
Neoplasm	DISZKGEW	Strong	Altered Expression	[21]
Nervous system inflammation	DISB3X5A	Strong	Biomarker	[20]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[14]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[14]
Peptic esophagitis	DISJSGBZ	Strong	Biomarker	[22]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[23]
Psoriasis	DIS59VMN	Strong	Biomarker	[24]
Skin disease	DISDW8R6	Strong	Biomarker	[4]
Colorectal carcinoma	DIS5PYL0	moderate	Altered Expression	[25]
Gastric neoplasm	DISOKN4Y	moderate	Altered Expression	[26]
Breast cancer	DIS7DPX1	Limited	Altered Expression	[21]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[21]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Biomarker	[27]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Limited	Biomarker	[28]
Invasive breast carcinoma	DISANYTW	Limited	Altered Expression	[29]
Liver cancer	DISDE4BI	Limited	Biomarker	[27]
Malignant pleural mesothelioma	DIST2R60	Limited	Biomarker	[30]
Mesothelioma	DISKWK9M	Limited	Biomarker	[30]
Sickle-cell anaemia	DIS5YNZB	Limited	Altered Expression	[31]
Subarachnoid hemorrhage	DISI7I8Y	Limited	Altered Expression	[32]
Triple negative breast cancer	DISAMG6N	Limited	Altered Expression	[33]

This DOT Affected the Regulation of Drug Effects of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Claudin-3 (CLDN3) increases the import of Cisplatin.	[58]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Claudin-3 (CLDN3) decreases the response to substance of Paclitaxel.	[59]
Capecitabine	DMTS85L	Approved	Claudin-3 (CLDN3) increases the response to substance of Capecitabine.	[59]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Claudin-3 (CLDN3).	[34]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Claudin-3 (CLDN3).	[49]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Claudin-3 (CLDN3).	[50]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Claudin-3 (CLDN3).	[35]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Claudin-3 (CLDN3).	[36]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Claudin-3 (CLDN3).	[37]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Claudin-3 (CLDN3).	[38]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Claudin-3 (CLDN3).	[39]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Claudin-3 (CLDN3).	[40]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Claudin-3 (CLDN3).	[41]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Claudin-3 (CLDN3).	[28]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Claudin-3 (CLDN3).	[43]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Claudin-3 (CLDN3).	[38]
Sanguinarine	DMDINFS	Approved	Sanguinarine decreases the expression of Claudin-3 (CLDN3).	[44]
Guanfacine extended release	DMB1CZ8	Approved	Guanfacine extended release decreases the expression of Claudin-3 (CLDN3).	[45]
Isoflavone	DM7U58J	Phase 4	Isoflavone decreases the expression of Claudin-3 (CLDN3).	[46]
Fenretinide	DMRD5SP	Phase 3	Fenretinide increases the expression of Claudin-3 (CLDN3).	[47]
CS-600G	DM1PV4Y	Phase 3	CS-600G increases the expression of Claudin-3 (CLDN3).	[48]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the expression of Claudin-3 (CLDN3).	[51]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Claudin-3 (CLDN3).	[52]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Claudin-3 (CLDN3).	[53]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID decreases the expression of Claudin-3 (CLDN3).	[54]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Claudin-3 (CLDN3).	[55]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone decreases the expression of Claudin-3 (CLDN3).	[56]
U0126	DM31OGF	Investigative	U0126 increases the expression of Claudin-3 (CLDN3).	[48]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PATULIN	DM0RV9C	Investigative	PATULIN affects the localization of Claudin-3 (CLDN3).	[57]

References

• [1] Plasma claudin-3 is associated with tumor necrosis factor-alpha-induced intestinal endotoxemia in liver disease.Clin Res Hepatol Gastroenterol. 2019 Aug;43(4):410-416. doi: 10.1016/j.clinre.2018.11.014. Epub 2019 Apr 30.
• [2] Identification of genes associated with matrix metalloproteinases in invasive lung adenocarcinoma.Oncol Lett. 2018 Jul;16(1):123-130. doi: 10.3892/ol.2018.8683. Epub 2018 May 10.
• [3] Rapid eradication of colon carcinoma by Clostridium perfringens Enterotoxin suicidal gene therapy.BMC Cancer. 2017 Feb 13;17(1):129. doi: 10.1186/s12885-017-3123-x.
• [4] Claudin-3 Loss Causes Leakage of Sweat from the Sweat Gland to Contribute to the Pathogenesis of Atopic Dermatitis.J Invest Dermatol. 2018 Jun;138(6):1279-1287. doi: 10.1016/j.jid.2017.11.040. Epub 2017 Dec 23.
• [5] Database-augmented Mass Spectrometry Analysis of Exosomes Identifies Claudin 3 as a Putative Prostate Cancer Biomarker.Mol Cell Proteomics. 2017 Jun;16(6):998-1008. doi: 10.1074/mcp.M117.068577. Epub 2017 Apr 9.
• [6] Claudin expression in breast cancer: high or low, what to expect?.Histol Histopathol. 2012 Oct;27(10):1283-95. doi: 10.14670/HH-27.1283.
• [7] Expression profile of tight junction protein claudin 3 and claudin 4 in ovarian serous adenocarcinoma with prognostic correlation.Histol Histopathol. 2007 Nov;22(11):1185-95. doi: 10.14670/HH-22.1185.
• [8] Altered Esophageal Mucosal Structure in Patients with Celiac Disease.Can J Gastroenterol Hepatol. 2016;2016:1980686. doi: 10.1155/2016/1980686. Epub 2016 Feb 29.
• [9] Impact of Sensitization and Inflammation on the Interaction of Mast Cells With the Intestinal Epithelium in Rats.Front Physiol. 2019 Mar 26;10:329. doi: 10.3389/fphys.2019.00329. eCollection 2019.
• [10] Claudins upregulation in human colorectal cancer.FEBS Lett. 2005 Nov 7;579(27):6179-85. doi: 10.1016/j.febslet.2005.09.091. Epub 2005 Oct 13.
• [11] Overexpression of claudin-3 and claudin-4 receptors in uterine serous papillary carcinoma: novel targets for a type-specific therapy using Clostridium perfringens enterotoxin (CPE).Cancer. 2007 Apr 1;109(7):1312-22. doi: 10.1002/cncr.22536.
• [12] Altered expression of claudin-3 and claudin-4 in ectopic endometrium of women with endometriosis.Fertil Steril. 2009 May;91(5):1692-9. doi: 10.1016/j.fertnstert.2007.11.095. Epub 2008 Apr 2.
• [13] Novel Clostridium perfringens enterotoxin suicide gene therapy for selective treatment of claudin-3- and -4-overexpressing tumors.Gene Ther. 2012 May;19(5):494-503. doi: 10.1038/gt.2011.136. Epub 2011 Oct 6.
• [14] Folate-linked lipoplexes for short hairpin RNA targeting claudin-3 delivery in ovarian cancer xenografts.J Control Release. 2013 Dec 28;172(3):679-89. doi: 10.1016/j.jconrel.2013.10.015. Epub 2013 Oct 18.
• [15] Methylation of the claudin? promoter predicts the prognosis of advanced gastric adenocarcinoma.Oncol Rep. 2018 Jul;40(1):49-60. doi: 10.3892/or.2018.6411. Epub 2018 May 2.
• [16] Down-regulation of claudin-3 is associated with proliferative potential in early gastric cancers.Dig Dis Sci. 2012 Jun;57(6):1562-7. doi: 10.1007/s10620-012-2043-5.
• [17] Recombinant VP1 protein as a potential marker for the diagnosis of acute hepatitis A virus infection.J Virol Methods. 2017 Jul;245:1-4. doi: 10.1016/j.jviromet.2017.03.005. Epub 2017 Mar 9.
• [18] Claudin-3 Inhibits Lung Squamous Cell Carcinoma Cell Epithelial-mesenchymal Transition and Invasion via Suppression of the Wnt/-catenin Signaling Pathway.Int J Med Sci. 2018 Feb 5;15(4):339-351. doi: 10.7150/ijms.22927. eCollection 2018.
• [19] Distinct presence of the tight junction protein claudin-3 in olfactory bulb and fila olfactoria of the mouse.Histol Histopathol. 2017 Aug;32(8):835-849. doi: 10.14670/HH-11-854. Epub 2016 Dec 12.
• [20] Disturbed function of the blood-cerebrospinal fluid barrier aggravates neuro-inflammation.Acta Neuropathol. 2014 Aug;128(2):267-77. doi: 10.1007/s00401-013-1227-1. Epub 2013 Dec 20.
• [21] Association of Cytokeratin 5 and Claudin 3 expression with BRCA1 and BRCA2 germline mutations in women with early breast cancer.BMC Cancer. 2019 Jul 15;19(1):695. doi: 10.1186/s12885-019-5908-6.
• [22] Dissociation and dispersion of claudin-3 from the tight junction could be one of the most sensitive indicators of reflux esophagitis in a rat model of the disease.J Gastroenterol. 2011 May;46(5):629-38. doi: 10.1007/s00535-011-0390-1. Epub 2011 Mar 5.
• [23] Identification of genes potentially involved in the acquisition of androgen-independent and metastatic tumor growth in an autochthonous genetically engineered mouse prostate cancer model.Prostate. 2007 Jan 1;67(1):83-106. doi: 10.1002/pros.20505.
• [24] Claudin-3 - a new intestinal integrity marker in patients with psoriasis: association with disease severity.J Eur Acad Dermatol Venereol. 2019 Oct;33(10):1907-1912. doi: 10.1111/jdv.15700. Epub 2019 Jun 19.
• [25] SCF/C-Kit/JNK/AP-1 Signaling Pathway Promotes Claudin-3 Expression in Colonic Epithelium and Colorectal Carcinoma.Int J Mol Sci. 2017 Apr 6;18(4):765. doi: 10.3390/ijms18040765.
• [26] Gastric and intestinal claudin expression at the invasive front of gastric carcinoma.Cancer Sci. 2007 Jul;98(7):1014-9. doi: 10.1111/j.1349-7006.2007.00490.x. Epub 2007 Apr 24.
• [27] CLDN3 inhibits cancer aggressiveness via Wnt-EMT signaling and is a potential prognostic biomarker for hepatocellular carcinoma.Oncotarget. 2014 Sep 15;5(17):7663-76. doi: 10.18632/oncotarget.2288.
• [28] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
• [29] Gene expression signatures and biomarkers of noninvasive and invasive breast cancer cells: comprehensive profiles by representational difference analysis, microarrays and proteomics.Oncogene. 2006 Apr 13;25(16):2328-38. doi: 10.1038/sj.onc.1209265.
• [30] Claudin 3, 4, and 15 expression in solid tumors of lung adenocarcinoma versus malignant pleural mesothelioma.Ann Diagn Pathol. 2015 Aug;19(4):193-7. doi: 10.1016/j.anndiagpath.2015.03.007. Epub 2015 Apr 14.
• [31] Depletion of Intestinal Microbiome Partially Rescues Bone Loss in Sickle Cell Disease Male Mice.Sci Rep. 2019 Jun 17;9(1):8659. doi: 10.1038/s41598-019-45270-4.
• [32] Artesunate Protected Blood-Brain Barrier via Sphingosine 1 Phosphate Receptor 1/Phosphatidylinositol 3 Kinase Pathway After Subarachnoid Hemorrhage in Rats.Mol Neurobiol. 2017 Mar;54(2):1213-1228. doi: 10.1007/s12035-016-9732-6. Epub 2016 Jan 28.
• [33] High-level cytoplasmic claudin 3 expression is an independent predictor of poor survival in triple-negative breast cancer.BMC Cancer. 2018 Feb 27;18(1):223. doi: 10.1186/s12885-018-4141-z.
• [34] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [35] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [36] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [37] Inorganic arsenic exposure promotes malignant progression by HDAC6-mediated down-regulation of HTRA1. J Appl Toxicol. 2023 Aug;43(8):1214-1224. doi: 10.1002/jat.4457. Epub 2023 Mar 11.
• [38] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [39] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [40] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [41] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [42] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
• [43] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [44] Anti-invasive activity of sanguinarine through modulation of tight junctions and matrix metalloproteinase activities in MDA-MB-231 human breast carcinoma cells. Chem Biol Interact. 2009 May 15;179(2-3):185-91. doi: 10.1016/j.cbi.2008.11.009. Epub 2008 Nov 21.
• [45] Palmitoylethanolamide and Cannabidiol Prevent Inflammation-induced Hyperpermeability of the Human Gut In Vitro and In Vivo-A Randomized, Placebo-controlled, Double-blind Controlled Trial. Inflamm Bowel Dis. 2019 May 4;25(6):1006-1018. doi: 10.1093/ibd/izz017.
• [46] Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
• [47] Regulation of lipocalin-2 gene by the cancer chemopreventive retinoid 4-HPR. Int J Cancer. 2006 Oct 1;119(7):1599-606.
• [48] Loxoprofen enhances intestinal barrier function via generation of its active metabolite by carbonyl reductase 1 in differentiated Caco-2?cells. Chem Biol Interact. 2021 Oct 1;348:109634. doi: 10.1016/j.cbi.2021.109634. Epub 2021 Sep 8.
• [49] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [50] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [51] A synthetic coumarin derivative (4-flourophenylacetamide-acetyl coumarin) impedes cell cycle at G0/G1 stage, induces apoptosis, and inhibits metastasis via ROS-mediated p53 and AKT signaling pathways in A549 cells. J Biochem Mol Toxicol. 2020 Oct;34(10):e22553. doi: 10.1002/jbt.22553. Epub 2020 Jun 24.
• [52] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [53] Mycotoxins modify the barrier function of Caco-2 cells through differential gene expression of specific claudin isoforms: Protective effect of illite mineral clay. Toxicology. 2016 Apr 15;353-354:21-33. doi: 10.1016/j.tox.2016.05.003. Epub 2016 May 3.
• [54] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.
• [55] Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.
• [56] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
• [57] The mycotoxin patulin, modulates tight junctions in caco-2 cells. Toxicol In Vitro. 2009 Feb;23(1):83-9. doi: 10.1016/j.tiv.2008.10.009. Epub 2008 Oct 29.
• [58] Claudin-3 and claudin-4 regulate sensitivity to cisplatin by controlling expression of the copper and cisplatin influx transporter CTR1. Mol Pharmacol. 2013 Jan;83(1):85-94. doi: 10.1124/mol.112.079798. Epub 2012 Oct 10.
• [59] Gene expression analysis using human cancer xenografts to identify novel predictive marker genes for the efficacy of 5-fluorouracil-based drugs. Cancer Sci. 2006 Jun;97(6):510-22. doi: 10.1111/j.1349-7006.2006.00204.x.