Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCDIR6X)

DOT Name 2,4-dienoyl-CoA reductase , mitochondrial (DECR1)
Synonyms EC 1.3.1.124; 2,4-dienoyl-CoA reductase ; 4-enoyl-CoA reductase ; Short chain dehydrogenase/reductase family 18C member 1
Gene Name DECR1
Related Disease
Nephropathy ( )
Non-alcoholic fatty liver disease ( )
Advanced cancer ( )
Alzheimer disease ( )
Autoimmune disease ( )
Cardiac failure ( )
Cardiomyopathy ( )
Cardiovascular disease ( )
Coronary atherosclerosis ( )
Fatty liver disease ( )
Glioblastoma multiforme ( )
Hepatocellular carcinoma ( )
Hyperglycemia ( )
Inflammatory bowel disease ( )
Lung cancer ( )
Lung carcinoma ( )
Myocardial infarction ( )
Neoplasm ( )
Neuroblastoma ( )
Non-insulin dependent diabetes ( )
Obesity ( )
Parkinson disease ( )
Pneumonitis ( )
Pulmonary arterial hypertension ( )
Pulmonary fibrosis ( )
Rheumatoid arthritis ( )
Stroke ( )
Systemic sclerosis ( )
Vascular disease ( )
Acute myelogenous leukaemia ( )
Coronary heart disease ( )
Esophageal adenocarcinoma ( )
G6PD deficiency ( )
Granulomatous disease, chronic, X-linked ( )
Type-1/2 diabetes ( )
Obstructive sleep apnea ( )
Pneumonia ( )
Amyotrophic lateral sclerosis ( )
Atrial fibrillation ( )
Chronic kidney disease ( )
Colorectal carcinoma ( )
Congestive heart failure ( )
Crohn disease ( )
Diabetic retinopathy ( )
Neuralgia ( )
Non-small-cell lung cancer ( )
Progressive encephalopathy with leukodystrophy due to DECR deficiency ( )
Systemic lupus erythematosus ( )
UniProt ID
DECR_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1W6U; 1W73; 1W8D
EC Number
1.3.1.124
Pfam ID
PF13561
Sequence
MKLPARVFFTLGSRLPCGLAPRRFFSYGTKILYQNTEALQSKFFSPLQKAMLPPNSFQGK
VAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRD
PDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIG
KQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQP
GPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFD
GGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
Function
Auxiliary enzyme of beta-oxidation. It participates in the metabolism of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in mitochondria. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA.
Tissue Specificity Heart = liver = pancreas > kidney >> skeletal muscle = lung.
Reactome Pathway
mitochondrial fatty acid beta-oxidation of unsaturated fatty acids (R-HSA-77288 )

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Nephropathy DISXWP4P Definitive Altered Expression [1]
Non-alcoholic fatty liver disease DISDG1NL Definitive Biomarker [2]
Advanced cancer DISAT1Z9 Strong Altered Expression [3]
Alzheimer disease DISF8S70 Strong Biomarker [4]
Autoimmune disease DISORMTM Strong Biomarker [5]
Cardiac failure DISDC067 Strong Biomarker [6]
Cardiomyopathy DISUPZRG Strong Biomarker [7]
Cardiovascular disease DIS2IQDX Strong Biomarker [8]
Coronary atherosclerosis DISKNDYU Strong Biomarker [9]
Fatty liver disease DIS485QZ Strong Biomarker [10]
Glioblastoma multiforme DISK8246 Strong Altered Expression [11]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [12]
Hyperglycemia DIS0BZB5 Strong Biomarker [13]
Inflammatory bowel disease DISGN23E Strong Genetic Variation [14]
Lung cancer DISCM4YA Strong Altered Expression [15]
Lung carcinoma DISTR26C Strong Altered Expression [16]
Myocardial infarction DIS655KI Strong Biomarker [6]
Neoplasm DISZKGEW Strong Altered Expression [17]
Neuroblastoma DISVZBI4 Strong Altered Expression [18]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [19]
Obesity DIS47Y1K Strong Altered Expression [20]
Parkinson disease DISQVHKL Strong Biomarker [21]
Pneumonitis DIS88E0K Strong Genetic Variation [22]
Pulmonary arterial hypertension DISP8ZX5 Strong Biomarker [23]
Pulmonary fibrosis DISQKVLA Strong Biomarker [24]
Rheumatoid arthritis DISTSB4J Strong Biomarker [25]
Stroke DISX6UHX Strong Altered Expression [26]
Systemic sclerosis DISF44L6 Strong Genetic Variation [27]
Vascular disease DISVS67S Strong Biomarker [28]
Acute myelogenous leukaemia DISCSPTN moderate Biomarker [29]
Coronary heart disease DIS5OIP1 moderate Biomarker [9]
Esophageal adenocarcinoma DISODWFP moderate Biomarker [30]
G6PD deficiency DISYF1GO moderate Biomarker [31]
Granulomatous disease, chronic, X-linked DISNTTS3 moderate Genetic Variation [5]
Type-1/2 diabetes DISIUHAP moderate Altered Expression [32]
Obstructive sleep apnea DIS0SVD1 Disputed Biomarker [33]
Pneumonia DIS8EF3M Disputed Genetic Variation [22]
Amyotrophic lateral sclerosis DISF7HVM Limited Altered Expression [34]
Atrial fibrillation DIS15W6U Limited Altered Expression [35]
Chronic kidney disease DISW82R7 Limited Biomarker [36]
Colorectal carcinoma DIS5PYL0 Limited Altered Expression [37]
Congestive heart failure DIS32MEA Limited Biomarker [6]
Crohn disease DIS2C5Q8 Limited Genetic Variation [38]
Diabetic retinopathy DISHGUJM Limited Biomarker [39]
Neuralgia DISWO58J Limited Biomarker [40]
Non-small-cell lung cancer DIS5Y6R9 Limited Biomarker [41]
Progressive encephalopathy with leukodystrophy due to DECR deficiency DISOCW9E Limited Unknown [42]
Systemic lupus erythematosus DISI1SZ7 Limited Altered Expression [43]
------------------------------------------------------------------------------------
⏷ Show the Full List of 48 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of 2,4-dienoyl-CoA reductase , mitochondrial (DECR1). [44]
------------------------------------------------------------------------------------
13 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of 2,4-dienoyl-CoA reductase , mitochondrial (DECR1). [45]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of 2,4-dienoyl-CoA reductase , mitochondrial (DECR1). [46]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of 2,4-dienoyl-CoA reductase , mitochondrial (DECR1). [47]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of 2,4-dienoyl-CoA reductase , mitochondrial (DECR1). [48]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of 2,4-dienoyl-CoA reductase , mitochondrial (DECR1). [49]
Quercetin DM3NC4M Approved Quercetin decreases the expression of 2,4-dienoyl-CoA reductase , mitochondrial (DECR1). [50]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of 2,4-dienoyl-CoA reductase , mitochondrial (DECR1). [51]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of 2,4-dienoyl-CoA reductase , mitochondrial (DECR1). [52]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of 2,4-dienoyl-CoA reductase , mitochondrial (DECR1). [53]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of 2,4-dienoyl-CoA reductase , mitochondrial (DECR1). [54]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of 2,4-dienoyl-CoA reductase , mitochondrial (DECR1). [55]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of 2,4-dienoyl-CoA reductase , mitochondrial (DECR1). [56]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of 2,4-dienoyl-CoA reductase , mitochondrial (DECR1). [57]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)

References

1 NADPH oxidase 4 promotes cisplatin-induced acute kidney injury via ROS-mediated programmed cell death and inflammation.Lab Invest. 2018 Jan;98(1):63-78. doi: 10.1038/labinvest.2017.120. Epub 2017 Nov 6.
2 The NOX1 isoform of NADPH oxidase is involved in dysfunction of liver sinusoids in nonalcoholic fatty liver disease.Free Radic Biol Med. 2018 Feb 1;115:412-420. doi: 10.1016/j.freeradbiomed.2017.12.019. Epub 2017 Dec 20.
3 Activated glycine receptors may decrease endosomal NADPH oxidase activity by opposing ClC-3-mediated efflux of chloride from endosomes.Med Hypotheses. 2019 Feb;123:125-129. doi: 10.1016/j.mehy.2019.01.012. Epub 2019 Jan 16.
4 Nuclear and mitochondrial DNA oxidation in Alzheimer's disease.Free Radic Res. 2012 Apr;46(4):565-76. doi: 10.3109/10715762.2011.648188. Epub 2012 Jan 23.
5 Health-Related Quality of Life and Emotional Health in X-Linked Carriers of Chronic Granulomatous Disease in the United Kingdom.J Clin Immunol. 2019 Feb;39(2):195-199. doi: 10.1007/s10875-019-00607-6. Epub 2019 Mar 13.
6 The NADPH oxidase inhibitor apocynin improves cardiac sympathetic nerve terminal innervation and function in heart failure.Exp Physiol. 2019 Nov;104(11):1638-1649. doi: 10.1113/EP087552. Epub 2019 Oct 10.
7 Engulfment and cell motility protein 1 potentiates diabetic cardiomyopathy via Rac-dependent and Rac-independent ROS production.JCI Insight. 2019 Jun 20;4(12):e127660. doi: 10.1172/jci.insight.127660. eCollection 2019 Jun 20.
8 NADPH oxidases and oxidase crosstalk in cardiovascular diseases: novel therapeutic targets.Nat Rev Cardiol. 2020 Mar;17(3):170-194. doi: 10.1038/s41569-019-0260-8. Epub 2019 Oct 7.
9 Roles of NADPH oxidase and mitochondria in flow-induced vasodilation of human adipose arterioles: ROS-induced ROS release in coronary artery disease.Microcirculation. 2017 Aug;24(6):10.1111/micc.12380. doi: 10.1111/micc.12380.
10 High fructose-containing drinking water-induced steatohepatitis in rats is prevented by the nicotinamide-mediated modulation of redox homeostasis and NADPH-producing enzymes.Mol Biol Rep. 2020 Jan;47(1):337-351. doi: 10.1007/s11033-019-05136-4. Epub 2019 Oct 24.
11 Primary glioblastoma transcriptome data analysis for screening survival-related genes.J Cell Biochem. 2020 Feb;121(2):1901-1910. doi: 10.1002/jcb.29425. Epub 2019 Oct 21.
12 6PGD inhibition sensitizes hepatocellular carcinoma to chemotherapy via AMPK activation and metabolic reprogramming.Biomed Pharmacother. 2019 Mar;111:1353-1358. doi: 10.1016/j.biopha.2019.01.028. Epub 2019 Jan 17.
13 Pyruvate-Carboxylase-Mediated Anaplerosis Promotes Antioxidant Capacity by Sustaining TCA Cycle and Redox Metabolism in Liver.Cell Metab. 2019 Jun 4;29(6):1291-1305.e8. doi: 10.1016/j.cmet.2019.03.014. Epub 2019 Apr 18.
14 NAPDH Oxidases in Inflammatory Bowel Disease.Methods Mol Biol. 2019;1982:695-713. doi: 10.1007/978-1-4939-9424-3_38.
15 Dysregulated Redox Regulation Contributes to Nuclear EGFR Localization and Pathogenicity in Lung Cancer.Sci Rep. 2019 Mar 19;9(1):4844. doi: 10.1038/s41598-019-41395-8.
16 Antitumor activity of BJ-1207, a 6-amino-2,4,5-trimethylpyridin-3-ol derivative, in human lung cancer.Chem Biol Interact. 2018 Oct 1;294:1-8. doi: 10.1016/j.cbi.2018.08.007. Epub 2018 Aug 17.
17 Tirapazamine-embedded polyplatinum(iv) complex: a prodrug combo for hypoxia-activated synergistic chemotherapy.Biomater Sci. 2020 Jan 21;8(2):694-701. doi: 10.1039/c9bm01640f.
18 The Human NADPH Oxidase, Nox4, Regulates Cytoskeletal Organization in Two Cancer Cell Lines, HepG2 and SH-SY5Y.Front Oncol. 2017 May 31;7:111. doi: 10.3389/fonc.2017.00111. eCollection 2017.
19 Superoxide and NADPH oxidase do not modulate skin blood flow in older exercising adults with and without type 2 diabetes.Microvasc Res. 2019 Sep;125:103886. doi: 10.1016/j.mvr.2019.103886. Epub 2019 Jun 12.
20 Adipose tissue-derived WNT5A regulates vascular redox signaling in obesity via USP17/RAC1-mediated activation of NADPH oxidases.Sci Transl Med. 2019 Sep 18;11(510):eaav5055. doi: 10.1126/scitranslmed.aav5055.
21 Inhibition of NADPH oxidase by apocynin prevents learning and memory deficits in a mouse Parkinson's disease model.Redox Biol. 2019 Apr;22:101134. doi: 10.1016/j.redox.2019.101134. Epub 2019 Feb 8.
22 Participation of NADPH Oxidase-Related Reactive Oxygen Species in Leptin-Promoted Pulmonary Inflammation: Regulation of cPLA2 and COX-2 Expression.Int J Mol Sci. 2019 Mar 2;20(5):1078. doi: 10.3390/ijms20051078.
23 Pulmonary Arterial Hypertension and Endothelial Dysfunction Is Linked to NADPH Oxidase-Derived Superoxide Formation in Venous Thrombosis and Pulmonary Embolism in Mice.Oxid Med Cell Longev. 2018 Jun 10;2018:1860513. doi: 10.1155/2018/1860513. eCollection 2018.
24 NADPH Oxidases and Aging Models of Lung Fibrosis.Methods Mol Biol. 2019;1982:487-496. doi: 10.1007/978-1-4939-9424-3_29.
25 Hydroxytyrosol promotes autophagy by regulating SIRT1 against advanced oxidation protein productinduced NADPH oxidase and inflammatory response.Int J Mol Med. 2019 Oct;44(4):1531-1540. doi: 10.3892/ijmm.2019.4300. Epub 2019 Aug 5.
26 Dual inhibition of NADPH oxidases and xanthine oxidase potently prevents salt-induced stroke in stroke-prone spontaneously hypertensive rats.Hypertens Res. 2019 Jul;42(7):981-989. doi: 10.1038/s41440-019-0246-2. Epub 2019 Mar 8.
27 N-Formyl Peptide Receptors Induce Radical Oxygen Production in Fibroblasts Derived From Systemic Sclerosis by Interacting With a Cleaved Form of Urokinase Receptor.Front Immunol. 2018 Apr 4;9:574. doi: 10.3389/fimmu.2018.00574. eCollection 2018.
28 p22phox promotes Ang-II-induced vascular smooth muscle cell phenotypic switch by regulating KLF4 expression.Biochem Biophys Res Commun. 2019 Jun 18;514(1):280-286. doi: 10.1016/j.bbrc.2019.04.128. Epub 2019 Apr 26.
29 The Role of Reactive Oxygen Species in Acute Myeloid Leukaemia.Int J Mol Sci. 2019 Nov 28;20(23):6003. doi: 10.3390/ijms20236003.
30 Role of Rac1 in regulation of NOX5-S function in Barrett's esophageal adenocarcinoma cells.Am J Physiol Cell Physiol. 2011 Aug;301(2):C413-20. doi: 10.1152/ajpcell.00027.2011. Epub 2011 Apr 27.
31 Frequency of glucose-6-phosphate dehydrogenase deficiency in malaria patients from six African countries enrolled in two randomized anti-malarial clinical trials.Malar J. 2011 Aug 17;10:241. doi: 10.1186/1475-2875-10-241.
32 Inhalation exposure to cigarette smoke induces endothelial nitric oxide synthase uncoupling and enhances vascular collagen deposition in streptozotocin-induced diabetic rats.Food Chem Toxicol. 2020 Feb;136:110988. doi: 10.1016/j.fct.2019.110988. Epub 2019 Nov 20.
33 Intermittent Hypoxia Induced Formation of "Endothelial Cell-Colony Forming Units (EC-CFUs)" Is Affected by ROS and Oxidative Stress.Front Neurol. 2018 Jun 14;9:447. doi: 10.3389/fneur.2018.00447. eCollection 2018.
34 A C9orf72-CARM1 axis regulates lipid metabolism under glucose starvation-induced nutrient stress.Genes Dev. 2018 Nov 1;32(21-22):1380-1397. doi: 10.1101/gad.315564.118. Epub 2018 Oct 26.
35 Redox State in Atrial Fibrillation Pathogenesis and Relevant Therapeutic Approaches.Curr Med Chem. 2019;26(5):765-779. doi: 10.2174/0929867324666170718130408.
36 Protective effects of Salvia miltiorrhiza on adenine-induced chronic renal failure by regulating the metabolic profiling and modulating the NADPH oxidase/ROS/ERK and TGF-/Smad signaling pathways.J Ethnopharmacol. 2018 Feb 15;212:153-165. doi: 10.1016/j.jep.2017.09.021. Epub 2017 Oct 12.
37 Expression of NOX Family Genes and Their Clinical Significance in Colorectal Cancer.Dig Dis Sci. 2018 Sep;63(9):2332-2340. doi: 10.1007/s10620-018-5121-5. Epub 2018 May 21.
38 A specific gene-microbe interaction drives the development of Crohn's disease-like colitis in mice.Sci Immunol. 2019 Apr 19;4(34):eaaw4341. doi: 10.1126/sciimmunol.aaw4341.
39 Diabetic retinopathy: Focus on NADPH oxidase and its potential as therapeutic target.Eur J Pharmacol. 2019 Jun 15;853:381-387. doi: 10.1016/j.ejphar.2019.04.038. Epub 2019 Apr 19.
40 Inhibition of NOX2 signaling limits pain-related behavior and improves motor function in male mice after spinal cord injury: Participation of IL-10/miR-155 pathways.Brain Behav Immun. 2019 Aug;80:73-87. doi: 10.1016/j.bbi.2019.02.024. Epub 2019 Feb 23.
41 NOX4 supports glycolysis and promotes glutamine metabolism in non-small cell lung cancer cells.Free Radic Biol Med. 2016 Dec;101:236-248. doi: 10.1016/j.freeradbiomed.2016.10.500. Epub 2016 Oct 27.
42 Mitochondrial 2,4-dienoyl-CoA reductase deficiency in mice results in severe hypoglycemia with stress intolerance and unimpaired ketogenesis. PLoS Genet. 2009 Jul;5(7):e1000543. doi: 10.1371/journal.pgen.1000543. Epub 2009 Jul 3.
43 NCF1-339 polymorphism is associated with altered formation of neutrophil extracellular traps, high serum interferon activity and antiphospholipid syndrome in systemic lupus erythematosus.Ann Rheum Dis. 2020 Feb;79(2):254-261. doi: 10.1136/annrheumdis-2019-215820. Epub 2019 Nov 8.
44 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
45 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
46 Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
47 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
48 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
49 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
50 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
51 Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
52 Growth inhibition of ovarian tumor-initiating cells by niclosamide. Mol Cancer Ther. 2012 Aug;11(8):1703-12.
53 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
54 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
55 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
56 Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
57 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.