Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH54FMR)

• DOT Name: Dual specificity protein phosphatase 2 (DUSP2)
• Synonyms: EC 3.1.3.16; EC 3.1.3.48; Dual specificity protein phosphatase PAC-1
• Gene Name: DUSP2
• Related Disease:
  Huntington disease
  Rheumatoid arthritis
  Adenocarcinoma
  Adult glioblastoma
  Advanced cancer
  Atrial fibrillation
  Autoimmune disease
  B-cell neoplasm
  Bipolar disorder
  Brain neoplasm
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cardiac failure
  Colitis
  Colon cancer
  Colon carcinoma
  Colonic neoplasm
  Congestive heart failure
  Endometriosis
  Glioblastoma multiforme
  Glioma
  High blood pressure
  Juvenile idiopathic arthritis
  Leukemia
  Lung cancer
  Lung carcinoma
  Metabolic disorder
  Migraine disorder
  Nervous system inflammation
  Non-small-cell lung cancer
  Pancreatic ductal carcinoma
  Parkinson disease
  Post-traumatic stress disorder
  Retinoblastoma
  Schizophrenia
  Mental disorder
  Small lymphocytic lymphoma
  Anxiety disorder
  Bladder cancer
  Colorectal carcinoma
  Matthew-Wood syndrome
  Metastatic malignant neoplasm
  Plasma cell myeloma
  Prostate cancer
  Prostate carcinoma
  Thyroid gland papillary carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
• UniProt ID: DUS2_HUMAN
• PDB ID: 1M3G
• EC Number: 3.1.3.16; 3.1.3.48
• Pfam ID: PF00782 ; PF00581
• Sequence:
  MGLEAARELECAALGTLLRDPREAERTLLLDCRPFLAFCRRHVRAARPVPWNALLRRRAR
  GPPAAVLACLLPDRALRTRLVRGELARAVVLDEGSASVAELRPDSPAHVLLAALLHETRA
  GPTAVYFLRGGFDGFQGCCPDLCSEAPAPALPPTGDKTSRSDSRAPVYDQGGPVEILPYL
  FLGSCSHSSDLQGLQACGITAVLNVSASCPNHFEGLFRYKSIPVEDNQMVEISAWFQEAI
  GFIDWVKNSGGRVLVHCQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSF
  MGQLLQFETQVLCH
• Function: Dephosphorylates both phosphorylated Thr and Tyr residues in MAPK1, and dephosphorylation of phosphotyrosine is slightly faster than that of phosphothreonine. Can dephosphorylate MAPK1.
• Tissue Specificity: Expressed in hematopoietic tissues.
• KEGG Pathway:
  MAPK sig.ling pathway (hsa04010)
  Efferocytosis (hsa04148)
• Reactome Pathway:
  Negative regulation of MAPK pathway (R-HSA-5675221)
  RAF-independent MAPK1/3 activation (R-HSA-112409)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Huntington disease	DISQPLA4	Definitive	Biomarker	[1]
Rheumatoid arthritis	DISTSB4J	Definitive	Biomarker	[2]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[3]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[6]
Autoimmune disease	DISORMTM	Strong	Biomarker	[7]
B-cell neoplasm	DISVY326	Strong	Biomarker	[8]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[9]
Brain neoplasm	DISY3EKS	Strong	Altered Expression	[10]
Breast cancer	DIS7DPX1	Strong	Biomarker	[11]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[11]
Breast neoplasm	DISNGJLM	Strong	Posttranslational Modification	[11]
Cardiac failure	DISDC067	Strong	Biomarker	[12]
Colitis	DISAF7DD	Strong	Biomarker	[13]
Colon cancer	DISVC52G	Strong	Altered Expression	[14]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[14]
Colonic neoplasm	DISSZ04P	Strong	Altered Expression	[15]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[12]
Endometriosis	DISX1AG8	Strong	Altered Expression	[16]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[4]
Glioma	DIS5RPEH	Strong	Biomarker	[10]
High blood pressure	DISY2OHH	Strong	Biomarker	[17]
Juvenile idiopathic arthritis	DISQZGBV	Strong	Biomarker	[18]
Leukemia	DISNAKFL	Strong	Genetic Variation	[19]
Lung cancer	DISCM4YA	Strong	Posttranslational Modification	[20]
Lung carcinoma	DISTR26C	Strong	Posttranslational Modification	[20]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[21]
Migraine disorder	DISFCQTG	Strong	Biomarker	[22]
Nervous system inflammation	DISB3X5A	Strong	Biomarker	[23]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[24]
Pancreatic ductal carcinoma	DIS26F9Q	Strong	Altered Expression	[25]
Parkinson disease	DISQVHKL	Strong	Biomarker	[26]
Post-traumatic stress disorder	DISHL1EY	Strong	Biomarker	[27]
Retinoblastoma	DISVPNPB	Strong	Biomarker	[28]
Schizophrenia	DISSRV2N	Strong	Biomarker	[29]
Mental disorder	DIS3J5R8	moderate	Biomarker	[30]
Small lymphocytic lymphoma	DIS30POX	moderate	Biomarker	[31]
Anxiety disorder	DISBI2BT	Limited	Biomarker	[32]
Bladder cancer	DISUHNM0	Limited	Biomarker	[33]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[14]
Matthew-Wood syndrome	DISA7HR7	Limited	Biomarker	[25]
Metastatic malignant neoplasm	DIS86UK6	Limited	Altered Expression	[34]
Plasma cell myeloma	DIS0DFZ0	Limited	Biomarker	[35]
Prostate cancer	DISF190Y	Limited	Altered Expression	[36]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[36]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Altered Expression	[37]
Urinary bladder cancer	DISDV4T7	Limited	Biomarker	[33]
Urinary bladder neoplasm	DIS7HACE	Limited	Biomarker	[33]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	Dual specificity protein phosphatase 2 (DUSP2) affects the response to substance of Etoposide.	[58]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Dual specificity protein phosphatase 2 (DUSP2).	[38]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Dual specificity protein phosphatase 2 (DUSP2).	[53]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[39]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[40]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[41]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[42]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Dual specificity protein phosphatase 2 (DUSP2).	[43]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[44]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Dual specificity protein phosphatase 2 (DUSP2).	[43]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[45]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[46]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[47]
Melphalan	DMOLNHF	Approved	Melphalan increases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[48]
Liothyronine	DM6IR3P	Approved	Liothyronine decreases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[49]
Epanova	DMHEAGL	Approved	Epanova increases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[50]
Rigosertib	DMOSTXF	Phase 3	Rigosertib decreases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[51]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[41]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[52]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[54]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[55]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[56]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Dual specificity protein phosphatase 2 (DUSP2).	[57]

References

• [1] Pituitary Adenylate Cyclase-Activating Polypeptide (PACAP) Enhances Hippocampal Synaptic Plasticity and Improves Memory Performance in Huntington's Disease.Mol Neurobiol. 2018 Nov;55(11):8263-8277. doi: 10.1007/s12035-018-0972-5. Epub 2018 Mar 10.
• [2] Potential role of platelets for atherosclerotic events in rheumatoid arthritis.FEBS Open Bio. 2018 Nov 6;8(12):1888-1896. doi: 10.1002/2211-5463.12531. eCollection 2018 Dec.
• [3] PACAP and PAC1 receptor expression in pancreatic ductal carcinoma.Oncol Lett. 2019 Dec;18(6):5725-5730. doi: 10.3892/ol.2019.10971. Epub 2019 Oct 8.
• [4] Neuroleptic Drugs and PACAP Differentially Affect the mRNA Expression of Genes Encoding PAC1/VPAC Type Receptors. Neurochem Res. 2017 Apr;42(4):943-952. doi: 10.1007/s11064-016-2127-2. Epub 2016 Nov 30.
• [5] Therapeutic targeting of the PI4K2A/PKR lysosome network is critical for misfolded protein clearance and survival in cancer cells.Oncogene. 2020 Jan;39(4):801-813. doi: 10.1038/s41388-019-1010-4. Epub 2019 Sep 25.
• [6] Digoxin and Platelet Activation in Patients With Atrial Fibrillation: In Vivo and In Vitro Study.J Am Heart Assoc. 2018 Nov 20;7(22):e009509. doi: 10.1161/JAHA.118.009509.
• [7] MAP4K Family Kinases and DUSP Family Phosphatases in T-Cell Signaling and Systemic Lupus Erythematosus.Cells. 2019 Nov 13;8(11):1433. doi: 10.3390/cells8111433.
• [8] Molecular evidence of Zn chelation of the procaspase activating compound B-PAC-1 in B cell lymphoma.Oncotarget. 2016 Jan 19;7(3):3461-76. doi: 10.18632/oncotarget.6505.
• [9] Role of the PACAP-PAC1-DISC1 and PACAP-PAC1-stathmin1 systems in schizophrenia and bipolar disorder: novel treatment mechanisms?.Pharmacogenomics. 2009 Dec;10(12):1967-78. doi: 10.2217/pgs.09.147.
• [10] Immunohistochemical Characterization of Procaspase-3 Overexpression as a Druggable Target With PAC-1, a Procaspase-3 Activator, in Canine and Human Brain Cancers.Front Oncol. 2019 Feb 25;9:96. doi: 10.3389/fonc.2019.00096. eCollection 2019.
• [11] Comparative epigenomics of human and mouse mammary tumors.Genes Chromosomes Cancer. 2009 Jan;48(1):83-97. doi: 10.1002/gcc.20620.
• [12] Pituitary adenylate cyclase activating polypeptide (PACAP) and its receptor 1 (PAC1) in the human infant brain and changes in the Sudden Infant Death Syndrome (SIDS).Neurobiol Dis. 2017 Jul;103:70-77. doi: 10.1016/j.nbd.2017.04.002. Epub 2017 Apr 6.
• [13] The phosphatase DUSP2 controls the activity of the transcription activator STAT3 and regulates TH17 differentiation.Nat Immunol. 2015 Dec;16(12):1263-73. doi: 10.1038/ni.3278. Epub 2015 Oct 19.
• [14] Differential expression of DUSP2 in left- and right-sided colon cancer is associated with poor prognosis in colorectal cancer.Oncol Lett. 2018 Apr;15(4):4207-4214. doi: 10.3892/ol.2018.7881. Epub 2018 Jan 26.
• [15] Differential coupling of the PAC1 SV1 splice variant on human colonic tumors to the activation of intracellular cAMP but not intracellular Ca2+ does not activate tumor proliferation.J Mol Neurosci. 2004;22(1-2):83-92. doi: 10.1385/JMN:22:1-2:83.
• [16] Hypoxia-inhibited DUSP2 expression promotes IL-6/STAT3 signaling in endometriosis.Am J Reprod Immunol. 2017 Oct;78(4). doi: 10.1111/aji.12690. Epub 2017 Apr 25.
• [17] Expression of vasoactive intestinal peptide and related receptors in overcirculation-induced pulmonary hypertension in piglets.Pediatr Res. 2009 Oct;66(4):395-9. doi: 10.1203/PDR.0b013e3181b33804.
• [18] Gene expression signatures in polyarticular juvenile idiopathic arthritis demonstrate disease heterogeneity and offer a molecular classification of disease subsets.Arthritis Rheum. 2009 Jul;60(7):2113-23. doi: 10.1002/art.24534.
• [19] Characterization of a variant of PAC-1 in large granular lymphocyte leukemia.Protein Expr Purif. 2003 Nov;32(1):52-60. doi: 10.1016/S1046-5928(03)00237-7.
• [20] The dual specificity phosphatase 2 gene is hypermethylated in human cancer and regulated by epigenetic mechanisms.BMC Cancer. 2016 Feb 1;16:49. doi: 10.1186/s12885-016-2087-6.
• [21] Targeting the PAC1 Receptor for Neurological and Metabolic Disorders.Curr Top Med Chem. 2019;19(16):1399-1417. doi: 10.2174/1568026619666190709092647.
• [22] Dynamic changes in CGRP, PACAP, and PACAP receptors in the trigeminovascular system of a novel repetitive electrical stimulation rat model: Relevant to migraine.Mol Pain. 2019 Jan-Dec;15:1744806918820452. doi: 10.1177/1744806918820452.
• [23] PACAP/PAC1 Regulation of Inflammation via Catecholaminergic Neurons in a Model of Multiple Sclerosis.J Mol Neurosci. 2019 Jul;68(3):439-451. doi: 10.1007/s12031-018-1137-8. Epub 2018 Jul 30.
• [24] MiR-34c-3p suppresses the proliferation and invasion of non-small cell lung cancer (NSCLC) by inhibiting PAC1/MAPK pathway.Int J Clin Exp Pathol. 2015 Jun 1;8(6):6312-22. eCollection 2015.
• [25] MiR-361-3p regulates ERK1/2-induced EMT via DUSP2 mRNA degradation in pancreatic ductal adenocarcinoma.Cell Death Dis. 2018 Jul 24;9(8):807. doi: 10.1038/s41419-018-0839-8.
• [26] New insights about the peculiar role of the 28-38 C-terminal segment and some selected residues in PACAP for signaling and neuroprotection.Biochem Pharmacol. 2018 Aug;154:193-202. doi: 10.1016/j.bcp.2018.04.024. Epub 2018 Apr 25.
• [27] Neural Mechanism of a Sex-Specific Risk Variant for Posttraumatic Stress Disorder in the Type I Receptor of the Pituitary Adenylate Cyclase Activating Polypeptide.Biol Psychiatry. 2015 Dec 15;78(12):840-7. doi: 10.1016/j.biopsych.2014.12.018. Epub 2015 Jan 9.
• [28] G-protein-coupled receptor kinase 3- and protein kinase C-mediated desensitization of the PACAP receptor type 1 in human Y-79 retinoblastoma cells.Neuropharmacology. 2001 Mar;40(3):394-407. doi: 10.1016/s0028-3908(00)00167-2.
• [29] PACAP Protects Adult Neural Stem Cells from the Neurotoxic Effect of Ketamine Associated with Decreased Apoptosis, ER Stress and mTOR Pathway Activation.PLoS One. 2017 Jan 26;12(1):e0170496. doi: 10.1371/journal.pone.0170496. eCollection 2017.
• [30] PACAP and PAC1 receptor in brain development and behavior.Neuropeptides. 2013 Dec;47(6):421-30. doi: 10.1016/j.npep.2013.10.005. Epub 2013 Oct 23.
• [31] Expression of executioner procaspases and their activation by a procaspase-activating compound in chronic lymphocytic leukemia cells.Blood. 2015 Feb 12;125(7):1126-36. doi: 10.1182/blood-2014-01-546796. Epub 2014 Dec 23.
• [32] Genetic polymorphisms in the PACAP and PAC1 receptor genes and treatment response to venlafaxine XR in generalized anxiety disorder.Psychiatry Res. 2013 Dec 30;210(3):1299-300. doi: 10.1016/j.psychres.2013.07.038. Epub 2013 Aug 22.
• [33] Loss of DUSP2 predicts a poor prognosis in patients with bladder cancer.Hum Pathol. 2019 Mar;85:152-161. doi: 10.1016/j.humpath.2018.11.007. Epub 2018 Nov 17.
• [34] Loss of dual-specificity phosphatase-2 promotes angiogenesis and metastasis via up-regulation of interleukin-8 in colon cancer.J Pathol. 2017 Apr;241(5):638-648. doi: 10.1002/path.4868.
• [35] Targeting executioner procaspase-3 with the procaspase-activating compound B-PAC-1 induces apoptosis in multiple myeloma cells.Exp Hematol. 2015 Nov;43(11):951-962.e3. doi: 10.1016/j.exphem.2015.07.005. Epub 2015 Aug 6.
• [36] PAC1-R null isoform expression in human prostate cancer tissue.Prostate. 2006 Apr 1;66(5):514-21. doi: 10.1002/pros.20356.
• [37] Expression of PACAP and PAC1 Receptor in Normal Human Thyroid Gland and in Thyroid Papillary Carcinoma.J Mol Neurosci. 2016 Oct;60(2):171-8. doi: 10.1007/s12031-016-0823-7. Epub 2016 Aug 26.
• [38] Nuclear and Mitochondrial DNA Methylation Patterns Induced by Valproic Acid in Human Hepatocytes. Chem Res Toxicol. 2017 Oct 16;30(10):1847-1854. doi: 10.1021/acs.chemrestox.7b00171. Epub 2017 Sep 13.
• [39] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [40] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [41] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [42] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [43] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [44] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [45] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [46] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [47] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [48] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [49] 2,3,7,8-tetrachlorodibenzo-p-dioxin augments the modulation of gene expression mediated by the thyroid hormone receptor. Toxicol Appl Pharmacol. 2004 Feb 1;194(3):201-10. doi: 10.1016/j.taap.2003.09.010.
• [50] Differential effects of omega-3 and omega-6 Fatty acids on gene expression in breast cancer cells. Breast Cancer Res Treat. 2007 Jan;101(1):7-16. doi: 10.1007/s10549-006-9269-x. Epub 2006 Jul 6.
• [51] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
• [52] Expression of endogenous retroviruses reflects increased usage of atypical enhancers in T cells. EMBO J. 2019 Jun 17;38(12):e101107. doi: 10.15252/embj.2018101107. Epub 2019 May 8.
• [53] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [54] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [55] Identification of gene markers for formaldehyde exposure in humans. Environ Health Perspect. 2007 Oct;115(10):1460-6. doi: 10.1289/ehp.10180.
• [56] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
• [57] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [58] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.