Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH85PI5)

DOT Name Mitogen-activated protein kinase 1 (MAPK1)
Synonyms MAP kinase 1; MAPK 1; EC 2.7.11.24; ERT1; Extracellular signal-regulated kinase 2; ERK-2; MAP kinase isoform p42; p42-MAPK; Mitogen-activated protein kinase 2; MAP kinase 2; MAPK 2
Gene Name MAPK1
Related Disease
Noonan syndrome 13 ( )
UniProt ID
MK01_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1PME ; 1TVO ; 1WZY ; 2OJG ; 2OJI ; 2OJJ ; 2Y9Q ; 3D42 ; 3D44 ; 3I5Z ; 3I60 ; 3SA0 ; 3TEI ; 3W55 ; 4FMQ ; 4FUX ; 4FUY ; 4FV0 ; 4FV1 ; 4FV2 ; 4FV3 ; 4FV4 ; 4FV5 ; 4FV6 ; 4FV7 ; 4FV8 ; 4FV9 ; 4G6N ; 4G6O ; 4H3P ; 4H3Q ; 4IZ5 ; 4IZ7 ; 4IZA ; 4N0S ; 4NIF ; 4O6E ; 4QP1 ; 4QP2 ; 4QP3 ; 4QP4 ; 4QP6 ; 4QP7 ; 4QP8 ; 4QP9 ; 4QPA ; 4QTA ; 4QTE ; 4XJ0 ; 4ZXT ; 4ZZM ; 4ZZN ; 4ZZO ; 5AX3 ; 5BUE ; 5BUI ; 5BUJ ; 5BVD ; 5BVE ; 5BVF ; 5K4I ; 5LCJ ; 5LCK ; 5NGU ; 5NHF ; 5NHH ; 5NHJ ; 5NHL ; 5NHO ; 5NHP ; 5NHV ; 5V60 ; 5V61 ; 5V62 ; 5WP1 ; 6D5Y ; 6DMG ; 6G54 ; 6G8X ; 6G91 ; 6G92 ; 6G93 ; 6G97 ; 6G9A ; 6G9D ; 6G9H ; 6G9J ; 6G9K ; 6G9M ; 6G9N ; 6GDM ; 6GDQ ; 6GE0 ; 6GJB ; 6GJD ; 6NBS ; 6OPG ; 6OPH ; 6OPI ; 6Q7K ; 6Q7S ; 6Q7T ; 6QA1 ; 6QA3 ; 6QA4 ; 6QAG ; 6QAH ; 6QAL ; 6QAQ ; 6QAW ; 6RQ4 ; 6SLG ; 7AUV ; 7E73 ; 7E75 ; 7NQQ ; 7NQW ; 7NR3 ; 7NR5 ; 7NR8 ; 7NR9 ; 7OPM ; 7W5O ; 7X4U ; 7XC1 ; 8AO2 ; 8AO3 ; 8AO4 ; 8AO5 ; 8AO6 ; 8AO7 ; 8AO8 ; 8AO9 ; 8AOA ; 8AOB ; 8AOC ; 8AOD ; 8AOE ; 8AOF ; 8AOG ; 8AOH ; 8AOI ; 8AOJ
EC Number
2.7.11.24
Pfam ID
PF00069
Sequence
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Function
Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade also plays a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1 and FXR1) and a variety of other signaling-related molecules (like ARHGEF2, DCC, FRS2 or GRB10). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade. Mediates phosphorylation of TPR in response to EGF stimulation. May play a role in the spindle assembly checkpoint. Phosphorylates PML and promotes its interaction with PIN1, leading to PML degradation. Phosphorylates CDK2AP2; Acts as a transcriptional repressor. Binds to a [GC]AAA[GC] consensus sequence. Repress the expression of interferon gamma-induced genes. Seems to bind to the promoter of CCL5, DMP1, IFIH1, IFITM1, IRF7, IRF9, LAMP3, OAS1, OAS2, OAS3 and STAT1. Transcriptional activity is independent of kinase activity.
KEGG Pathway
EGFR tyrosine ki.se inhibitor resistance (hsa01521 )
Endocrine resistance (hsa01522 )
Platinum drug resistance (hsa01524 )
MAPK sig.ling pathway (hsa04010 )
ErbB sig.ling pathway (hsa04012 )
Ras sig.ling pathway (hsa04014 )
Rap1 sig.ling pathway (hsa04015 )
cGMP-PKG sig.ling pathway (hsa04022 )
cAMP sig.ling pathway (hsa04024 )
Chemokine sig.ling pathway (hsa04062 )
HIF-1 sig.ling pathway (hsa04066 )
FoxO sig.ling pathway (hsa04068 )
Sphingolipid sig.ling pathway (hsa04071 )
Phospholipase D sig.ling pathway (hsa04072 )
Oocyte meiosis (hsa04114 )
Autophagy - animal (hsa04140 )
Efferocytosis (hsa04148 )
mTOR sig.ling pathway (hsa04150 )
PI3K-Akt sig.ling pathway (hsa04151 )
Apoptosis (hsa04210 )
Cellular senescence (hsa04218 )
Adrenergic sig.ling in cardiomyocytes (hsa04261 )
Vascular smooth muscle contraction (hsa04270 )
TGF-beta sig.ling pathway (hsa04350 )
Axon guidance (hsa04360 )
VEGF sig.ling pathway (hsa04370 )
Apelin sig.ling pathway (hsa04371 )
Osteoclast differentiation (hsa04380 )
Focal adhesion (hsa04510 )
Adherens junction (hsa04520 )
Gap junction (hsa04540 )
Sig.ling pathways regulating pluripotency of stem cells (hsa04550 )
Platelet activation (hsa04611 )
Neutrophil extracellular trap formation (hsa04613 )
Toll-like receptor sig.ling pathway (hsa04620 )
NOD-like receptor sig.ling pathway (hsa04621 )
C-type lectin receptor sig.ling pathway (hsa04625 )
.tural killer cell mediated cytotoxicity (hsa04650 )
IL-17 sig.ling pathway (hsa04657 )
Th1 and Th2 cell differentiation (hsa04658 )
Th17 cell differentiation (hsa04659 )
T cell receptor sig.ling pathway (hsa04660 )
B cell receptor sig.ling pathway (hsa04662 )
Fc epsilon RI sig.ling pathway (hsa04664 )
Fc gamma R-mediated phagocytosis (hsa04666 )
TNF sig.ling pathway (hsa04668 )
Circadian entrainment (hsa04713 )
Long-term potentiation (hsa04720 )
Neurotrophin sig.ling pathway (hsa04722 )
Retrograde endocan.binoid sig.ling (hsa04723 )
Glutamatergic sy.pse (hsa04724 )
Cholinergic sy.pse (hsa04725 )
Serotonergic sy.pse (hsa04726 )
Long-term depression (hsa04730 )
Regulation of actin cytoskeleton (hsa04810 )
Insulin sig.ling pathway (hsa04910 )
GnRH sig.ling pathway (hsa04912 )
Progesterone-mediated oocyte maturation (hsa04914 )
Estrogen sig.ling pathway (hsa04915 )
Melanogenesis (hsa04916 )
Prolactin sig.ling pathway (hsa04917 )
Thyroid hormone sig.ling pathway (hsa04919 )
Oxytocin sig.ling pathway (hsa04921 )
Relaxin sig.ling pathway (hsa04926 )
Parathyroid hormone synthesis, secretion and action (hsa04928 )
GnRH secretion (hsa04929 )
Type II diabetes mellitus (hsa04930 )
AGE-RAGE sig.ling pathway in diabetic complications (hsa04933 )
Cushing syndrome (hsa04934 )
Growth hormone synthesis, secretion and action (hsa04935 )
Aldosterone-regulated sodium reabsorption (hsa04960 )
Alzheimer disease (hsa05010 )
Prion disease (hsa05020 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Alcoholism (hsa05034 )
Pathogenic Escherichia coli infection (hsa05130 )
Shigellosis (hsa05131 )
Salmonella infection (hsa05132 )
Pertussis (hsa05133 )
Yersinia infection (hsa05135 )
Leishmaniasis (hsa05140 )
Chagas disease (hsa05142 )
Toxoplasmosis (hsa05145 )
Tuberculosis (hsa05152 )
Hepatitis C (hsa05160 )
Hepatitis B (hsa05161 )
Human cytomegalovirus infection (hsa05163 )
Influenza A (hsa05164 )
Human papillomavirus infection (hsa05165 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Human immunodeficiency virus 1 infection (hsa05170 )
Coro.virus disease - COVID-19 (hsa05171 )
Pathways in cancer (hsa05200 )
Viral carcinogenesis (hsa05203 )
Proteoglycans in cancer (hsa05205 )
MicroR.s in cancer (hsa05206 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Chemical carcinogenesis - reactive oxygen species (hsa05208 )
Colorectal cancer (hsa05210 )
Re.l cell carcinoma (hsa05211 )
Pancreatic cancer (hsa05212 )
Endometrial cancer (hsa05213 )
Glioma (hsa05214 )
Prostate cancer (hsa05215 )
Thyroid cancer (hsa05216 )
Melanoma (hsa05218 )
Bladder cancer (hsa05219 )
Chronic myeloid leukemia (hsa05220 )
Acute myeloid leukemia (hsa05221 )
Non-small cell lung cancer (hsa05223 )
Breast cancer (hsa05224 )
Hepatocellular carcinoma (hsa05225 )
Gastric cancer (hsa05226 )
Central carbon metabolism in cancer (hsa05230 )
Choline metabolism in cancer (hsa05231 )
PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
Lipid and atherosclerosis (hsa05417 )
Reactome Pathway
RAF-independent MAPK1/3 activation (R-HSA-112409 )
MAPK1 (ERK2) activation (R-HSA-112411 )
Signaling by NODAL (R-HSA-1181150 )
Spry regulation of FGF signaling (R-HSA-1295596 )
Signaling by Activin (R-HSA-1502540 )
Golgi Cisternae Pericentriolar Stack Reorganization (R-HSA-162658 )
Frs2-mediated activation (R-HSA-170968 )
ERK/MAPK targets (R-HSA-198753 )
ERKs are inactivated (R-HSA-202670 )
Regulation of actin dynamics for phagocytic cup formation (R-HSA-2029482 )
Downregulation of SMAD2/3 (R-HSA-2173795 )
SMAD2/SMAD3 (R-HSA-2173796 )
Oxidative Stress Induced Senescence (R-HSA-2559580 )
Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582 )
Oncogene Induced Senescence (R-HSA-2559585 )
FCERI mediated MAPK activation (R-HSA-2871796 )
Regulation of HSF1-mediated heat shock response (R-HSA-3371453 )
NCAM signaling for neurite out-growth (R-HSA-375165 )
Recycling pathway of L1 (R-HSA-437239 )
RSK activation (R-HSA-444257 )
Signal transduction by L1 (R-HSA-445144 )
Activation of the AP-1 family of transcription factors (R-HSA-450341 )
Thrombin signalling through proteinase activated receptors (PARs) (R-HSA-456926 )
Negative regulation of FGFR1 signaling (R-HSA-5654726 )
Negative regulation of FGFR2 signaling (R-HSA-5654727 )
Negative regulation of FGFR3 signaling (R-HSA-5654732 )
Negative regulation of FGFR4 signaling (R-HSA-5654733 )
RHO GTPases Activate WASPs and WAVEs (R-HSA-5663213 )
RHO GTPases Activate NADPH Oxidases (R-HSA-5668599 )
RAF/MAP kinase cascade (R-HSA-5673001 )
MAP2K and MAPK activation (R-HSA-5674135 )
Negative feedback regulation of MAPK pathway (R-HSA-5674499 )
Negative regulation of MAPK pathway (R-HSA-5675221 )
Neutrophil degranulation (R-HSA-6798695 )
Signaling by moderate kinase activity BRAF mutants (R-HSA-6802946 )
Signaling by high-kinase activity BRAF mutants (R-HSA-6802948 )
Signaling by BRAF and RAF1 fusions (R-HSA-6802952 )
Paradoxical activation of RAF signaling by kinase inactive BRAF (R-HSA-6802955 )
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 )
Signal attenuation (R-HSA-74749 )
Interferon gamma signaling (R-HSA-877300 )
Advanced glycosylation endproduct receptor signaling (R-HSA-879415 )
Gastrin-CREB signalling pathway via PKC and MAPK (R-HSA-881907 )
ESR-mediated signaling (R-HSA-8939211 )
RUNX2 regulates osteoblast differentiation (R-HSA-8940973 )
Regulation of PTEN gene transcription (R-HSA-8943724 )
Regulation of the apoptosome activity (R-HSA-9627069 )
Estrogen-stimulated signaling through PRKCZ (R-HSA-9634635 )
Estrogen-dependent nuclear events downstream of ESR-membrane signaling (R-HSA-9634638 )
Suppression of apoptosis (R-HSA-9635465 )
Signaling downstream of RAS mutants (R-HSA-9649948 )
Signaling by MAP2K mutants (R-HSA-9652169 )
Signaling by MAPK mutants (R-HSA-9652817 )
Signaling by RAF1 mutants (R-HSA-9656223 )
FCGR3A-mediated phagocytosis (R-HSA-9664422 )
Nuclear events stimulated by ALK signaling in cancer (R-HSA-9725371 )
IFNG signaling activates MAPKs (R-HSA-9732724 )
NPAS4 regulates expression of target genes (R-HSA-9768919 )
Growth hormone receptor signaling (R-HSA-982772 )
phospho-PLA2 pathway (R-HSA-111995 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Noonan syndrome 13 DISBYU1Y Strong Autosomal dominant [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 4 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Dacarbazine DMNPZL4 Approved Mitogen-activated protein kinase 1 (MAPK1) decreases the response to substance of Dacarbazine. [99]
Urokinase DM0GOUD Approved Mitogen-activated protein kinase 1 (MAPK1) increases the Diabetes mellitus ADR of Urokinase. [100]
PF-04691502 DMS610L Phase 2 Mitogen-activated protein kinase 1 (MAPK1) affects the response to substance of PF-04691502. [101]
3R14S-OCHRATOXIN A DM2KEW6 Investigative Mitogen-activated protein kinase 1 (MAPK1) increases the response to substance of 3R14S-OCHRATOXIN A. [102]
------------------------------------------------------------------------------------
69 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Mitogen-activated protein kinase 1 (MAPK1). [2]
Ciclosporin DMAZJFX Approved Ciclosporin increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [3]
Tretinoin DM49DUI Approved Tretinoin decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [4]
Acetaminophen DMUIE76 Approved Acetaminophen increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [8]
Arsenic DMTL2Y1 Approved Arsenic increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [11]
Quercetin DM3NC4M Approved Quercetin decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [12]
Temozolomide DMKECZD Approved Temozolomide increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [13]
Decitabine DMQL8XJ Approved Decitabine increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [21]
Zoledronate DMIXC7G Approved Zoledronate decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [23]
Phenobarbital DMXZOCG Approved Phenobarbital increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [24]
Progesterone DMUY35B Approved Progesterone decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [25]
Menadione DMSJDTY Approved Menadione increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [26]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [27]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [28]
Folic acid DMEMBJC Approved Folic acid increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [30]
Niclosamide DMJAGXQ Approved Niclosamide decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [31]
Troglitazone DM3VFPD Approved Troglitazone decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [34]
Hydroquinone DM6AVR4 Approved Hydroquinone decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [35]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [36]
Azathioprine DMMZSXQ Approved Azathioprine increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [37]
Ethanol DMDRQZU Approved Ethanol decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [38]
Etoposide DMNH3PG Approved Etoposide increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [40]
Diclofenac DMPIHLS Approved Diclofenac increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [42]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [44]
Dasatinib DMJV2EK Approved Dasatinib decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [45]
Indomethacin DMSC4A7 Approved Indomethacin decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [46]
Mitomycin DMH0ZJE Approved Mitomycin increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [47]
Permethrin DMZ0Q1G Approved Permethrin decreases the methylation of Mitogen-activated protein kinase 1 (MAPK1). [48]
Gemcitabine DMSE3I7 Approved Gemcitabine increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [51]
Sulindac DM2QHZU Approved Sulindac increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [52]
Methamphetamine DMPM4SK Approved Methamphetamine affects the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [54]
Daunorubicin DMQUSBT Approved Daunorubicin decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [55]
Pioglitazone DMKJ485 Approved Pioglitazone decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [56]
Acocantherin DM7JT24 Approved Acocantherin decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [57]
Thalidomide DM70BU5 Approved Thalidomide increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [58]
Phenytoin DMNOKBV Approved Phenytoin decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [60]
Ursodeoxycholic acid DMCUT21 Approved Ursodeoxycholic acid increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [62]
Fluoxetine DM3PD2C Approved Fluoxetine decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [65]
Sodium phenylbutyrate DMXLBCQ Approved Sodium phenylbutyrate decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [66]
Beta-carotene DM0RXBT Approved Beta-carotene increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [67]
Imatinib DM7RJXL Approved Imatinib decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [68]
Sertraline DM0FB1J Approved Sertraline increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [69]
Estrone DM5T6US Approved Estrone increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [70]
Docetaxel DMDI269 Approved Docetaxel increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [72]
Isoproterenol DMK7MEY Approved Isoproterenol increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [73]
Propofol DMB4OLE Approved Propofol decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [76]
Glucosamine DM4ZLFD Approved Glucosamine increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [77]
Isoniazid DM5JVS3 Approved Isoniazid decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [78]
Sevoflurane DMC9O43 Approved Sevoflurane increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [76]
Adenosine DMM2NSK Approved Adenosine decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [79]
Morphine DMRMS0L Approved Morphine increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [80]
Eicosapentaenoic acid/docosa-hexaenoic acid DMMUCG4 Approved Eicosapentaenoic acid/docosa-hexaenoic acid increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [81]
Dihydroxyacetone DMM1LG2 Approved Dihydroxyacetone increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [82]
Crizotinib DM4F29C Approved Crizotinib decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [83]
Ciprofloxacin XR DM2NLS9 Approved Ciprofloxacin XR increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [84]
Cantharidin DMBP5N3 Approved Cantharidin increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [85]
Tetracycline DMZA017 Approved Tetracycline decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [86]
Methimazole DM25FL8 Approved Methimazole decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [87]
Mebendazole DMO14SG Approved Mebendazole increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [88]
Romidepsin DMT5GNL Approved Romidepsin decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [89]
Trovafloxacin DM6AN32 Approved Trovafloxacin increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [91]
Ergotidine DM78IME Approved Ergotidine increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [92]
Masoprocol DMMVNZ0 Approved Masoprocol decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [94]
Carvedilol DMHTEAO Approved Carvedilol increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [73]
Allopurinol DMLPAOB Approved Allopurinol increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [95]
Epirubicin DMPDW6T Approved Epirubicin increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [96]
Sanguinarine DMDINFS Approved Sanguinarine increases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [97]
Omacetaxine mepesuccinate DMPU2WX Approved Omacetaxine mepesuccinate decreases the phosphorylation of Mitogen-activated protein kinase 1 (MAPK1). [98]
------------------------------------------------------------------------------------
⏷ Show the Full List of 69 Drug(s)
31 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Mitogen-activated protein kinase 1 (MAPK1). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Mitogen-activated protein kinase 1 (MAPK1). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Mitogen-activated protein kinase 1 (MAPK1). [9]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Mitogen-activated protein kinase 1 (MAPK1). [10]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Mitogen-activated protein kinase 1 (MAPK1). [14]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the activity of Mitogen-activated protein kinase 1 (MAPK1). [15]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the activity of Mitogen-activated protein kinase 1 (MAPK1). [16]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Mitogen-activated protein kinase 1 (MAPK1). [17]
Testosterone DM7HUNW Approved Testosterone increases the activity of Mitogen-activated protein kinase 1 (MAPK1). [18]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Mitogen-activated protein kinase 1 (MAPK1). [19]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Mitogen-activated protein kinase 1 (MAPK1). [20]
Marinol DM70IK5 Approved Marinol increases the expression of Mitogen-activated protein kinase 1 (MAPK1). [22]
Dexamethasone DMMWZET Approved Dexamethasone decreases the activity of Mitogen-activated protein kinase 1 (MAPK1). [29]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of Mitogen-activated protein kinase 1 (MAPK1). [32]
Bortezomib DMNO38U Approved Bortezomib decreases the activity of Mitogen-activated protein kinase 1 (MAPK1). [33]
Aspirin DM672AH Approved Aspirin decreases the expression of Mitogen-activated protein kinase 1 (MAPK1). [39]
Paclitaxel DMLB81S Approved Paclitaxel decreases the activity of Mitogen-activated protein kinase 1 (MAPK1). [41]
Nicotine DMWX5CO Approved Nicotine increases the activity of Mitogen-activated protein kinase 1 (MAPK1). [43]
Ethinyl estradiol DMODJ40 Approved Ethinyl estradiol increases the activity of Mitogen-activated protein kinase 1 (MAPK1). [49]
Simvastatin DM30SGU Approved Simvastatin decreases the activity of Mitogen-activated protein kinase 1 (MAPK1). [50]
Capsaicin DMGMF6V Approved Capsaicin decreases the activity of Mitogen-activated protein kinase 1 (MAPK1). [53]
Lindane DMB8CNL Approved Lindane decreases the expression of Mitogen-activated protein kinase 1 (MAPK1). [59]
Sorafenib DMS8IFC Approved Sorafenib decreases the activity of Mitogen-activated protein kinase 1 (MAPK1). [61]
Gefitinib DM15F0X Approved Gefitinib decreases the expression of Mitogen-activated protein kinase 1 (MAPK1). [63]
Diphenylpyraline DMW4X37 Approved Diphenylpyraline decreases the expression of Mitogen-activated protein kinase 1 (MAPK1). [64]
Dinoprostone DMTYOPD Approved Dinoprostone increases the activity of Mitogen-activated protein kinase 1 (MAPK1). [71]
Lovastatin DM9OZWQ Approved Lovastatin decreases the activity of Mitogen-activated protein kinase 1 (MAPK1). [50]
Ardeparin DMYRX8B Approved Ardeparin increases the activity of Mitogen-activated protein kinase 1 (MAPK1). [74]
Adenosine triphosphate DM79F6G Approved Adenosine triphosphate increases the activity of Mitogen-activated protein kinase 1 (MAPK1). [75]
Lapatinib DM3BH1Y Approved Lapatinib decreases the activity of Mitogen-activated protein kinase 1 (MAPK1). [90]
Busulfan DMXYJ9C Approved Busulfan increases the activity of Mitogen-activated protein kinase 1 (MAPK1). [93]
------------------------------------------------------------------------------------
⏷ Show the Full List of 31 Drug(s)

References

1 MAPK1E322K mutation increases head and neck squamous cell carcinoma sensitivity to erlotinib through enhanced secretion of amphiregulin. Oncotarget. 2016 Apr 26;7(17):23300-11. doi: 10.18632/oncotarget.8188.
2 Nuclear and Mitochondrial DNA Methylation Patterns Induced by Valproic Acid in Human Hepatocytes. Chem Res Toxicol. 2017 Oct 16;30(10):1847-1854. doi: 10.1021/acs.chemrestox.7b00171. Epub 2017 Sep 13.
3 Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
4 All-trans retinoic acid downregulates ALK in neuroblastoma cell lines and induces apoptosis in neuroblastoma cell lines with activated ALK. Cancer Lett. 2010 Nov 28;297(2):220-5. doi: 10.1016/j.canlet.2010.05.014. Epub 2010 Jun 23.
5 Caffeic acid attenuated acetaminophen-induced hepatotoxicity by inhibiting ERK1/2-mediated early growth response-1 transcriptional activation. Chem Biol Interact. 2016 Dec 25;260:186-195. doi: 10.1016/j.cbi.2016.10.009. Epub 2016 Oct 6.
6 Asbestos modulates thioredoxin-thioredoxin interacting protein interaction to regulate inflammasome activation. Part Fibre Toxicol. 2014 May 20;11:24. doi: 10.1186/1743-8977-11-24.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 Treatment with anticancer agents induces dysregulation of specific Wnt signaling pathways in human ovarian luteinized granulosa cells in vitro. Toxicol Sci. 2013 Nov;136(1):183-92. doi: 10.1093/toxsci/kft175. Epub 2013 Aug 16.
9 Molecular mechanism of action of bisphenol and bisphenol A mediated by oestrogen receptor alpha in growth and apoptosis of breast cancer cells. Br J Pharmacol. 2013 May;169(1):167-78.
10 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
11 Reactive oxygen species contribute to arsenic-induced EZH2 phosphorylation in human bronchial epithelial cells and lung cancer cells. Toxicol Appl Pharmacol. 2014 May 1;276(3):165-70. doi: 10.1016/j.taap.2014.02.005. Epub 2014 Feb 25.
12 Suppression of insulin-like growth factor signalling pathway and collagen expression in keloid-derived fibroblasts by quercetin: its therapeutic potential use in the treatment and/or prevention of keloids. Br J Dermatol. 2003 Mar;148(3):544-52. doi: 10.1046/j.1365-2133.2003.05174.x.
13 Thymoquinone induces apoptosis in temozolomide-resistant glioblastoma cells via the p38 mitogen-activated protein kinase signaling pathway. Environ Toxicol. 2023 Jan;38(1):90-100. doi: 10.1002/tox.23664. Epub 2022 Sep 29.
14 An approach to elucidate potential mechanism of renal toxicity of arsenic trioxide. Exp Hematol. 2007 Feb;35(2):252-62.
15 APE1/Ref-1 prevents oxidative inactivation of ERK for G1-to-S progression following lead acetate exposure. Toxicology. 2013 Mar 8;305:120-9. doi: 10.1016/j.tox.2013.01.010. Epub 2013 Jan 28.
16 Vitamin D3 induces autophagy in human monocytes/macrophages via cathelicidin. Cell Host Microbe. 2009 Sep 17;6(3):231-43. doi: 10.1016/j.chom.2009.08.004.
17 The proteasome inhibitor bortezomib interacts synergistically with histone deacetylase inhibitors to induce apoptosis in Bcr/Abl+ cells sensitive and resistant to STI571. Blood. 2003 Nov 15;102(10):3765-74. doi: 10.1182/blood-2003-03-0737. Epub 2003 Jul 31.
18 Dominant roles of the Raf/MEK/ERK pathway in cell cycle progression, prevention of apoptosis and sensitivity to chemotherapeutic drugs. Cell Cycle. 2010 Apr 15;9(8):1629-38. doi: 10.4161/cc.9.8.11487. Epub 2010 Apr 15.
19 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
20 Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
21 Down-regulation of Rap1GAP via promoter hypermethylation promotes melanoma cell proliferation, survival, and migration. Cancer Res. 2009 Jan 15;69(2):449-57. doi: 10.1158/0008-5472.CAN-08-2399.
22 Genomic and proteomic analysis of the effects of cannabinoids on normal human astrocytes. Brain Res. 2008 Jan 29;1191:1-11.
23 Zoledronic acid induces antiproliferative and apoptotic effects in human pancreatic cancer cells in vitro. Br J Cancer. 2003 Jun 16;88(12):1971-8. doi: 10.1038/sj.bjc.6600986.
24 Non-dioxin-like-PCBs phosphorylate Mdm2 at Ser166 and attenuate the p53 response in HepG2 cells. Chem Biol Interact. 2009 Dec 10;182(2-3):191-8. doi: 10.1016/j.cbi.2009.09.004. Epub 2009 Sep 12.
25 Progesterone increases csk homologous kinase in HMC-1560 human mast cells and reduces cell proliferation. J Cell Biochem. 2007 Dec 1;102(5):1271-80. doi: 10.1002/jcb.21357.
26 DLPC and SAMe prevent alpha1(I) collagen mRNA up-regulation in human hepatic stellate cells, whether caused by leptin or menadione. Biochem Biophys Res Commun. 2006 Nov 10;350(1):50-5. doi: 10.1016/j.bbrc.2006.08.174. Epub 2006 Sep 18.
27 Nicotine increases survival in human colon cancer cells treated with chemotherapeutic drugs. Toxicol In Vitro. 2013 Dec;27(8):2256-63. doi: 10.1016/j.tiv.2013.09.020. Epub 2013 Oct 2.
28 Estrogen and pure antiestrogen fulvestrant (ICI 182 780) augment cell-matrigel adhesion of MCF-7 breast cancer cells through a novel G protein coupled estrogen receptor (GPR30)-to-calpain signaling axis. Toxicol Appl Pharmacol. 2014 Mar 1;275(2):176-81. doi: 10.1016/j.taap.2014.01.005. Epub 2014 Jan 17.
29 Dexamethasone suppresses DU145 cell proliferation and cell cycle through inhibition of the extracellular signal-regulated kinase 1/2 pathway and cyclin D1 expression. Asian J Androl. 2008 Jul;10(4):635-41. doi: 10.1111/j.1745-7262.2008.00352.x. Epub 2007 Dec 20.
30 Folic acid mediates activation of the pro-oncogene STAT3 via the Folate Receptor alpha. Cell Signal. 2015 Jul;27(7):1356-68. doi: 10.1016/j.cellsig.2015.03.020. Epub 2015 Apr 2.
31 Niclosamide, an anti-helminthic molecule, downregulates the retroviral oncoprotein Tax and pro-survival Bcl-2 proteins in HTLV-1-transformed T lymphocytes. Biochem Biophys Res Commun. 2015 Aug 14;464(1):221-228. doi: 10.1016/j.bbrc.2015.06.120. Epub 2015 Jun 23.
32 Cannabidiol Modulates the Immunophenotype and Inhibits the Activation of the Inflammasome in Human Gingival Mesenchymal Stem Cells. Front Physiol. 2016 Nov 24;7:559. doi: 10.3389/fphys.2016.00559. eCollection 2016.
33 Mitochondrial Bax translocation partially mediates synergistic cytotoxicity between histone deacetylase inhibitors and proteasome inhibitors in glioma cells. Neuro Oncol. 2008 Jun;10(3):309-19. doi: 10.1215/15228517-2007-063. Epub 2008 Apr 29.
34 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
35 p38 MAPK/PP2Ac/TTP pathway on the connection of TNF- and caspases activation on hydroquinone-induced apoptosis. Carcinogenesis. 2013 Apr;34(4):818-27. doi: 10.1093/carcin/bgs409. Epub 2013 Jan 3.
36 Rosiglitazone inhibits alpha4 nicotinic acetylcholine receptor expression in human lung carcinoma cells through peroxisome proliferator-activated receptor gamma-independent signals. Mol Cancer Ther. 2009 Jan;8(1):110-8. doi: 10.1158/1535-7163.MCT-08-0719.
37 Azathioprine desensitizes liver cancer cells to insulin-like growth factor 1 and causes apoptosis when it is combined with bafilomycin A1. Toxicol Appl Pharmacol. 2013 Nov 1;272(3):568-78. doi: 10.1016/j.taap.2013.07.024. Epub 2013 Aug 16.
38 Downregulation of mitogen-activated protein kinases (MAPKs) in chronic ethanol-induced fatty liver. Toxicol Mech Methods. 2020 Jul;30(6):407-416. doi: 10.1080/15376516.2020.1747126. Epub 2020 Apr 1.
39 [Aspirin inhibits proliferation and expression of p44/42 MAPK phosphorylation in vascular endothelial cells]. Di Yi Jun Yi Da Xue Xue Bao. 2004 Sep;24(9):1013-5.
40 Modulation of apoptosis in HaCaT keratinocytes via differential regulation of ERK signaling pathway by flavonoids. J Biol Chem. 2005 Sep 9;280(36):31498-507. doi: 10.1074/jbc.M505537200. Epub 2005 Jul 13.
41 The stent-eluting drugs sirolimus and paclitaxel suppress healing of the endothelium by induction of autophagy. Am J Pathol. 2009 Nov;175(5):2226-34.
42 Evaluation and mechanistic analysis of the cytotoxicity of the acyl glucuronide of nonsteroidal anti-inflammatory drugs. Drug Metab Dispos. 2014 Jan;42(1):1-8. doi: 10.1124/dmd.113.054478. Epub 2013 Oct 8.
43 A functional role for nicotine in Bcl2 phosphorylation and suppression of apoptosis. J Biol Chem. 2003 Jan 17;278(3):1886-91. doi: 10.1074/jbc.M209044200. Epub 2002 Nov 5.
44 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
45 The kinase inhibitor dasatinib induces apoptosis in chronic lymphocytic leukemia cells in vitro with preference for a subgroup of patients with unmutated IgVH genes. Blood. 2008 Aug 15;112(4):1443-52. doi: 10.1182/blood-2007-11-123984. Epub 2008 Jun 12.
46 Indomethacin-enhanced anticancer effect of arsenic trioxide in A549 cell line: involvement of apoptosis and phospho-ERK and p38 MAPK pathways. Biomed Res Int. 2013;2013:237543.
47 Curcumin enhances the mitomycin C-induced cytotoxicity via downregulation of MKK1/2-ERK1/2-mediated Rad51 expression in non-small cell lung cancer cells. Toxicol Appl Pharmacol. 2011 Sep 15;255(3):327-38. doi: 10.1016/j.taap.2011.07.012. Epub 2011 Jul 24.
48 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
49 Synthetic estrogen-mediated activation of ERK 2 intracellular signaling molecule. Gynecol Endocrinol. 2003 Oct;17(5):423-8. doi: 10.1080/09513590312331290338.
50 Simvastatin and lovastatin inhibit breast cell invasion induced by H-Ras. Oncol Rep. 2009 May;21(5):1317-22. doi: 10.3892/or_00000357.
51 Extracellular signal-regulated kinase activation and Bcl-2 downregulation mediate apoptosis after gemcitabine treatment partly via a p53-independent pathway. Eur J Pharmacol. 2004 Oct 19;502(3):169-83. doi: 10.1016/j.ejphar.2004.09.006.
52 Combination treatment with arsenic trioxide and sulindac enhances apoptotic cell death in lung cancer cells via activation of oxidative stress and mitogen-activated protein kinases. Oncol Rep. 2008 Aug;20(2):379-84.
53 Roles of JNK-1 and p38 in selective induction of apoptosis by capsaicin in ras-transformed human breast epithelial cells. Int J Cancer. 2003 Feb 10;103(4):475-82. doi: 10.1002/ijc.10855.
54 Methamphetamine exposure upregulates the amyloid precursor protein and hyperphosphorylated tau expression: The roles of insulin signaling in SH-SY5Y cell line. J Toxicol Sci. 2019;44(7):493-503. doi: 10.2131/jts.44.493.
55 CREB/Sp1-mediated MCL1 expression and NFB-mediated ABCB1 expression modulate the cytotoxicity of daunorubicin in chronic myeloid leukemia cells. Toxicol Appl Pharmacol. 2022 Jan 15;435:115847. doi: 10.1016/j.taap.2021.115847. Epub 2021 Dec 25.
56 Pioglitazone, a PPAR agonist, attenuates PDGF-induced vascular smooth muscle cell proliferation through AMPK-dependent and AMPK-independent inhibition of mTOR/p70S6K and ERK signaling. Biochem Pharmacol. 2016 Feb 1;101:54-70. doi: 10.1016/j.bcp.2015.11.026. Epub 2015 Nov 28.
57 Ouabain impairs cell migration, and invasion and alters gene expression of human osteosarcoma U-2 OS cells. Environ Toxicol. 2017 Nov;32(11):2400-2413. doi: 10.1002/tox.22453. Epub 2017 Aug 10.
58 Antimyeloma activity of two novel N-substituted and tetraflourinated thalidomide analogs. Leukemia. 2005 Jul;19(7):1253-61. doi: 10.1038/sj.leu.2403776.
59 Long-term exposure to beta-hexachlorocyclohexane (beta-HCH) promotes transformation and invasiveness of MCF-7 human breast cancer cells. Biochem Pharmacol. 2003 Sep 1;66(5):831-40. doi: 10.1016/s0006-2952(03)00394-0.
60 Impaired degradation of matrix collagen in human gingival fibroblasts by the antiepileptic drug phenytoin. J Periodontol. 2005 Jun;76(6):941-50. doi: 10.1902/jop.2005.76.6.941.
61 Differential effects of arsenic trioxide on chemosensitization in human hepatic tumor and stellate cell lines. BMC Cancer. 2012 Sep 10;12:402.
62 Ursodeoxycholic acid but not tauroursodeoxycholic acid inhibits proliferation and differentiation of human subcutaneous adipocytes. PLoS One. 2013 Dec 3;8(12):e82086. doi: 10.1371/journal.pone.0082086. eCollection 2013.
63 Growth of hormone-dependent MCF-7 breast cancer cells is promoted by constitutive caveolin-1 whose expression is lost in an EGF-R-mediated manner during development of tamoxifen resistance. Breast Cancer Res Treat. 2010 Feb;119(3):575-91. doi: 10.1007/s10549-009-0355-8. Epub 2009 Mar 15.
64 Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
65 Fluoxetine inhibits the extracellular signal regulated kinase pathway and suppresses growth of cancer cells. Cancer Biol Ther. 2008 Oct;7(10):1685-93. doi: 10.4161/cbt.7.10.6664. Epub 2008 Oct 22.
66 Selenite induced breast cancer MCF7 cells apoptosis through endoplasmic reticulum stress and oxidative stress pathway. Chem Biol Interact. 2021 Nov 1;349:109651. doi: 10.1016/j.cbi.2021.109651. Epub 2021 Sep 11.
67 Growth stimulation of human pulmonary adenocarcinoma cells and small airway epithelial cells by beta-carotene via activation of cAMP, PKA, CREB and ERK1/2. Int J Cancer. 2006 Mar 15;118(6):1370-80. doi: 10.1002/ijc.21537.
68 Imatinib mesylate inhibits T-cell proliferation in vitro and delayed-type hypersensitivity in vivo. Blood. 2004 Aug 15;104(4):1094-9. doi: 10.1182/blood-2003-12-4266. Epub 2004 Apr 20.
69 Sertraline, an antidepressant, induces apoptosis in hepatic cells through the mitogen-activated protein kinase pathway. Toxicol Sci. 2014 Feb;137(2):404-15. doi: 10.1093/toxsci/kft254. Epub 2013 Nov 5.
70 LC, a novel estrone-rhein hybrid compound, promotes proliferation and differentiation and protects against cell death in human osteoblastic MG-63 cells. Mol Cell Endocrinol. 2011 Sep 15;344(1-2):59-68. doi: 10.1016/j.mce.2011.06.027. Epub 2011 Jul 13.
71 Celecoxib induces hepatic stellate cell apoptosis through inhibition of Akt activation and suppresses hepatic fibrosis in rats. Gut. 2009 Nov;58(11):1517-27. doi: 10.1136/gut.2008.157420. Epub 2009 Feb 6.
72 Docetaxel induces p53-dependent apoptosis and synergizes with farnesyl transferase inhibitor r115777 in human epithelial cancer cells. Front Biosci. 2005 Sep 1;10:2566-75. doi: 10.2741/1720.
73 A unique mechanism of beta-blocker action: carvedilol stimulates beta-arrestin signaling. Proc Natl Acad Sci U S A. 2007 Oct 16;104(42):16657-62. doi: 10.1073/pnas.0707936104. Epub 2007 Oct 9.
74 Heparin prevents programmed cell death in human trophoblast. Mol Hum Reprod. 2006 Apr;12(4):237-43. doi: 10.1093/molehr/gal026. Epub 2006 Mar 23.
75 Interactive effects of in vitro binge-like alcohol and ATP on umbilical endothelial nitric oxide synthase post-translational modifications and redox modulation. Reprod Toxicol. 2014 Jan;43:94-101.
76 Sevoflurane but not propofol enhances ovarian cancer cell biology through regulating cellular metabolic and signaling mechanisms. Cell Biol Toxicol. 2023 Aug;39(4):1395-1411. doi: 10.1007/s10565-022-09766-6. Epub 2022 Oct 8.
77 Disease-modifying effects of glucosamine HCl involving regulation of metalloproteinases and chemokines activated by interleukin-1beta in human primary synovial fibroblasts. J Cell Biochem. 2008 May 1;104(1):38-50. doi: 10.1002/jcb.21597.
78 Quercetin protected against isoniazide-induced HepG2 cell apoptosis by activating the SIRT1/ERK pathway. J Biochem Mol Toxicol. 2019 Sep;33(9):e22369. doi: 10.1002/jbt.22369. Epub 2019 Jul 23.
79 Adenosine downregulates DPPIV on HT-29 colon cancer cells by stimulating protein tyrosine phosphatase(s) and reducing ERK1/2 activity via a novel pathway. Am J Physiol Cell Physiol. 2006 Sep;291(3):C433-44.
80 opioid receptor agonist-selective regulation of interleukin-4 in T lymphocytes. J Neuroimmunol. 2013 Oct 15;263(1-2):35-42. doi: 10.1016/j.jneuroim.2013.07.012. Epub 2013 Jul 25.
81 Insight into the molecular mechanism of heme oxygenase-1 induction by docosahexaenoic acid in U937 cells. Chem Biol Interact. 2015 Aug 5;238:180-8. doi: 10.1016/j.cbi.2015.07.005. Epub 2015 Jul 7.
82 The sunless tanning agent dihydroxyacetone induces stress response gene expression and signaling in cultured human keratinocytes and reconstructed epidermis. Redox Biol. 2020 Sep;36:101594. doi: 10.1016/j.redox.2020.101594. Epub 2020 May 29.
83 Therapeutic strategies to overcome crizotinib resistance in non-small cell lung cancers harboring the fusion oncogene EML4-ALK. Proc Natl Acad Sci U S A. 2011 May 3;108(18):7535-40. doi: 10.1073/pnas.1019559108. Epub 2011 Apr 18.
84 Ciprofloxacin mediates cancer stem cell phenotypes in lung cancer cells through caveolin-1-dependent mechanism. Chem Biol Interact. 2016 Apr 25;250:1-11.
85 Anticancer effects of cantharidin in A431 human skin cancer (Epidermoid carcinoma) cells in vitro and in vivo. Environ Toxicol. 2017 Mar;32(3):723-738. doi: 10.1002/tox.22273. Epub 2016 Apr 25.
86 Increased hepatic Fatty Acid uptake and esterification contribute to tetracycline-induced steatosis in mice. Toxicol Sci. 2015 Jun;145(2):273-82. doi: 10.1093/toxsci/kfv049. Epub 2015 Mar 4.
87 Low-expressional IGF1 mediated methimazole-induced liver developmental toxicity in fetal mice. Toxicology. 2018 Sep 1;408:70-79. doi: 10.1016/j.tox.2018.07.004. Epub 2018 Jul 7.
88 Stimulation of pro-inflammatory responses by mebendazole in human monocytic THP-1 cells through an ERK signaling pathway. Arch Toxicol. 2011 Mar;85(3):199-207. doi: 10.1007/s00204-010-0584-y. Epub 2010 Sep 17.
89 Inhibitors of class I HDACs and of FLT3 combine synergistically against leukemia cells with mutant FLT3. Arch Toxicol. 2022 Jan;96(1):177-193. doi: 10.1007/s00204-021-03174-1. Epub 2021 Oct 19.
90 CDK4/6 inhibition provides a potent adjunct to Her2-targeted therapies in preclinical breast cancer models. Genes Cancer. 2014 Jul;5(7-8):261-72. doi: 10.18632/genesandcancer.24.
91 TNF enhances trovafloxacin-induced in vitro hepatotoxicity by inhibiting protective autophagy. Toxicol Lett. 2021 May 15;342:73-84. doi: 10.1016/j.toxlet.2021.02.009. Epub 2021 Feb 17.
92 Histamine stimulation of MMP-1(collagenase-1) secretion and gene expression in gastric epithelial cells: role of EGFR transactivation and the MAP kinase pathway. Int J Biochem Cell Biol. 2007;39(11):2143-52. doi: 10.1016/j.biocel.2007.06.003. Epub 2007 Jun 24.
93 Busulfan selectively induces cellular senescence but not apoptosis in WI38 fibroblasts via a p53-independent but extracellular signal-regulated kinase-p38 mitogen-activated protein kinase-dependent mechanism. J Pharmacol Exp Ther. 2006 Nov;319(2):551-60. doi: 10.1124/jpet.106.107771. Epub 2006 Aug 1.
94 Reactive oxygen species and lipoxygenases regulate the oncogenicity of NPM-ALK-positive anaplastic large cell lymphomas. Oncogene. 2009 Jul 23;28(29):2690-6.
95 Allopurinol induces innate immune responses through mitogen-activated protein kinase signaling pathways in HL-60 cells. J Appl Toxicol. 2016 Sep;36(9):1120-8. doi: 10.1002/jat.3272. Epub 2015 Dec 7.
96 (-)-Gossypol enhances the anticancer activity of epirubicin via downregulating survivin in hepatocellular carcinoma. Chem Biol Interact. 2022 Sep 1;364:110060. doi: 10.1016/j.cbi.2022.110060. Epub 2022 Jul 22.
97 Sanguinarine induces apoptosis in A549 human lung cancer cells primarily via cellular glutathione depletion. Toxicol In Vitro. 2009 Mar;23(2):281-7. doi: 10.1016/j.tiv.2008.12.013. Epub 2008 Dec 24.
98 Homoharringtonine suppresses LoVo cell growth by inhibiting EphB4 and the PI3K/AKT and MAPK/EKR1/2 signaling pathways. Food Chem Toxicol. 2020 Feb;136:110960. doi: 10.1016/j.fct.2019.110960. Epub 2019 Nov 11.
99 Exposure of melanoma cells to dacarbazine results in enhanced tumor growth and metastasis in vivo. J Clin Oncol. 2004 Jun 1;22(11):2092-100. doi: 10.1200/JCO.2004.11.070. Epub 2004 May 3.
100 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
101 Synergistic inhibition of ovarian cancer cell growth by combining selective PI3K/mTOR and RAS/ERK pathway inhibitors. Eur J Cancer. 2013 Dec;49(18):3936-44. doi: 10.1016/j.ejca.2013.08.007. Epub 2013 Sep 3.
102 ERK and p38 MAPK signaling pathways are involved in ochratoxin A-induced G2 phase arrest in human gastric epithelium cells. Toxicol Lett. 2012 Mar 7;209(2):186-92. doi: 10.1016/j.toxlet.2011.12.011. Epub 2011 Dec 30.