Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMH8BKJ)

• DOT Name: Neuroendocrine secretory protein 55 (GNAS)
• Synonyms: NESP55
• Gene Name: GNAS
• Related Disease:
  ACTH-independent macronodular adrenal hyperplasia 1
  Lung adenocarcinoma
  McCune-Albright syndrome
  Pseudohypoparathyroidism type 1A
  Pseudohypoparathyroidism type 1B
  Pseudohypoparathyroidism type 1C
  Pseudopseudohypoparathyroidism
  Respiratory disease
  Adenoma
  Adrenal gland cancer
  Adrenocortical carcinoma
  Advanced cancer
  Anxiety
  Bleeding disorder
  Breast neoplasm
  Central precocious puberty
  Cholangiocarcinoma
  Colon cancer
  Colorectal adenocarcinoma
  Colorectal neoplasm
  Cutaneous melanoma
  Gastric adenocarcinoma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Hypothyroidism
  Intellectual disability
  Intrahepatic cholangiocarcinoma
  Osteoarthritis
  Osteoporosis
  Pancreatic adenocarcinoma
  Polycystic kidney disease
  Polycystic ovarian syndrome
  Progressive osseous heteroplasia
  Schizophrenia
  Substance withdrawal syndrome
  Type-1/2 diabetes
  Cholestasis
  Hyperthyroidism
  Neuroblastoma
  Pituitary adenoma
  Thyroid tumor
  Adrenal gland neoplasm
  Brachydactyly
  Colorectal carcinoma
  Endocrine disease
  High blood pressure
  Obesity
  Sarcoma
• UniProt ID: GNAS3_HUMAN
• Pfam ID: PF06390
• Sequence:
  MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQ
  RRSFLNAHHRSGAQVFPESPESESDHEHEEADLELSLPECLEYEEEFDYETESETESEIE
  SETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPP
  STQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPI
  PIRRH
• KEGG Pathway:
  Endocrine resistance (hsa01522)
  Rap1 sig.ling pathway (hsa04015)
  Calcium sig.ling pathway (hsa04020)
  cAMP sig.ling pathway (hsa04024)
  Phospholipase D sig.ling pathway (hsa04072)
  Adrenergic sig.ling in cardiomyocytes (hsa04261)
  Vascular smooth muscle contraction (hsa04270)
  Gap junction (hsa04540)
  Platelet activation (hsa04611)
  Circadian entrainment (hsa04713)
  Thermogenesis (hsa04714)
  Glutamatergic sy.pse (hsa04724)
  Serotonergic sy.pse (hsa04726)
  Dopaminergic sy.pse (hsa04728)
  Long-term depression (hsa04730)
  Inflammatory mediator regulation of TRP channels (hsa04750)
  Insulin secretion (hsa04911)
  GnRH sig.ling pathway (hsa04912)
  Ovarian steroidogenesis (hsa04913)
  Estrogen sig.ling pathway (hsa04915)
  Melanogenesis (hsa04916)
  Thyroid hormone synthesis (hsa04918)
  Oxytocin sig.ling pathway (hsa04921)
  Glucagon sig.ling pathway (hsa04922)
  Regulation of lipolysis in adipocytes (hsa04923)
  Renin secretion (hsa04924)
  Aldosterone synthesis and secretion (hsa04925)
  Relaxin sig.ling pathway (hsa04926)
  Cortisol synthesis and secretion (hsa04927)
  Parathyroid hormone synthesis, secretion and action (hsa04928)
  Cushing syndrome (hsa04934)
  Growth hormone synthesis, secretion and action (hsa04935)
  Endocrine and other factor-regulated calcium reabsorption (hsa04961)
  Vasopressin-regulated water reabsorption (hsa04962)
  Salivary secretion (hsa04970)
  Gastric acid secretion (hsa04971)
  Pancreatic secretion (hsa04972)
  Bile secretion (hsa04976)
  Parkinson disease (hsa05012)
  Cocaine addiction (hsa05030)
  Amphetamine addiction (hsa05031)
  Morphine addiction (hsa05032)
  Alcoholism (hsa05034)
  Vibrio cholerae infection (hsa05110)
  Chagas disease (hsa05142)
  Amoebiasis (hsa05146)
  Human cytomegalovirus infection (hsa05163)
  Human papillomavirus infection (hsa05165)
  Pathways in cancer (hsa05200)
  Chemical carcinogenesis - receptor activation (hsa05207)
  Dilated cardiomyopathy (hsa05414)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
ACTH-independent macronodular adrenal hyperplasia 1	DISH2YV8	Definitive	Somatic mosaicism	[1]
Lung adenocarcinoma	DISD51WR	Definitive	Genetic Variation	[2]
McCune-Albright syndrome	DISCO2QT	Definitive	Somatic mosaicism	[1]
Pseudohypoparathyroidism type 1A	DISSOR3M	Definitive	Mitochondrial	[1]
Pseudohypoparathyroidism type 1B	DIS9LDXL	Definitive	Autosomal dominant	[3]
Pseudohypoparathyroidism type 1C	DISL5UEM	Definitive	Mitochondrial	[1]
Pseudopseudohypoparathyroidism	DISRRO5I	Definitive	Mitochondrial	[1]
Respiratory disease	DISGGAGJ	Definitive	Biomarker	[4]
Adenoma	DIS78ZEV	Strong	Genetic Variation	[5]
Adrenal gland cancer	DISNFZKJ	Strong	Biomarker	[6]
Adrenocortical carcinoma	DISZF4HX	Strong	Genetic Variation	[7]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[8]
Anxiety	DISIJDBA	Strong	Genetic Variation	[9]
Bleeding disorder	DIS27CUA	Strong	Biomarker	[10]
Breast neoplasm	DISNGJLM	Strong	Genetic Variation	[7]
Central precocious puberty	DISW1TFK	Strong	Biomarker	[11]
Cholangiocarcinoma	DIS71F6X	Strong	Biomarker	[12]
Colon cancer	DISVC52G	Strong	Genetic Variation	[13]
Colorectal adenocarcinoma	DISPQOUB	Strong	Genetic Variation	[13]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[13]
Cutaneous melanoma	DIS3MMH9	Strong	Genetic Variation	[7]
Gastric adenocarcinoma	DISWWLTC	Strong	Genetic Variation	[7]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Genetic Variation	[7]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[7]
Hypothyroidism	DISR0H6D	Strong	Genetic Variation	[14]
Intellectual disability	DISMBNXP	Strong	Biomarker	[15]
Intrahepatic cholangiocarcinoma	DIS6GOC8	Strong	Biomarker	[16]
Osteoarthritis	DIS05URM	Strong	Biomarker	[17]
Osteoporosis	DISF2JE0	Strong	Biomarker	[18]
Pancreatic adenocarcinoma	DISKHX7S	Strong	Genetic Variation	[7]
Polycystic kidney disease	DISWS3UY	Strong	Biomarker	[19]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[20]
Progressive osseous heteroplasia	DISOHTWF	Strong	Autosomal dominant	[21]
Schizophrenia	DISSRV2N	Strong	Biomarker	[22]
Substance withdrawal syndrome	DISTT24U	Strong	Biomarker	[23]
Type-1/2 diabetes	DISIUHAP	Strong	Genetic Variation	[24]
Cholestasis	DISDJJWE	moderate	Biomarker	[25]
Hyperthyroidism	DISX87ZH	moderate	Genetic Variation	[26]
Neuroblastoma	DISVZBI4	moderate	Biomarker	[27]
Pituitary adenoma	DISJ5R1X	moderate	Genetic Variation	[28]
Thyroid tumor	DISLVKMD	moderate	Genetic Variation	[29]
Adrenal gland neoplasm	DISFK7RF	Limited	Biomarker	[6]
Brachydactyly	DIS2533F	Limited	Genetic Variation	[30]
Colorectal carcinoma	DIS5PYL0	Limited	Genetic Variation	[13]
Endocrine disease	DISRGY2N	Limited	Genetic Variation	[31]
High blood pressure	DISY2OHH	Limited	Genetic Variation	[32]
Obesity	DIS47Y1K	Limited	Biomarker	[33]
Sarcoma	DISZDG3U	Limited	Genetic Variation	[34]

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Neuroendocrine secretory protein 55 (GNAS) decreases the response to substance of Cisplatin.	[56]
Isoproterenol	DMK7MEY	Approved	Neuroendocrine secretory protein 55 (GNAS) increases the response to substance of Isoproterenol.	[57]
Dobutamine	DMD1B8Z	Approved	Neuroendocrine secretory protein 55 (GNAS) increases the response to substance of Dobutamine.	[58]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Neuroendocrine secretory protein 55 (GNAS).	[35]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Neuroendocrine secretory protein 55 (GNAS).	[37]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Neuroendocrine secretory protein 55 (GNAS).	[38]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Neuroendocrine secretory protein 55 (GNAS).	[39]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Neuroendocrine secretory protein 55 (GNAS).	[40]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Neuroendocrine secretory protein 55 (GNAS).	[41]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Neuroendocrine secretory protein 55 (GNAS).	[42]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Neuroendocrine secretory protein 55 (GNAS).	[44]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Neuroendocrine secretory protein 55 (GNAS).	[45]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Neuroendocrine secretory protein 55 (GNAS).	[46]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Neuroendocrine secretory protein 55 (GNAS).	[47]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Neuroendocrine secretory protein 55 (GNAS).	[44]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Neuroendocrine secretory protein 55 (GNAS).	[48]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Neuroendocrine secretory protein 55 (GNAS).	[47]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Neuroendocrine secretory protein 55 (GNAS).	[49]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Neuroendocrine secretory protein 55 (GNAS).	[51]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Neuroendocrine secretory protein 55 (GNAS).	[52]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Neuroendocrine secretory protein 55 (GNAS).	[54]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Neuroendocrine secretory protein 55 (GNAS).	[55]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Neuroendocrine secretory protein 55 (GNAS).	[41]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the methylation of Neuroendocrine secretory protein 55 (GNAS).	[36]
Triclosan	DMZUR4N	Approved	Triclosan increases the methylation of Neuroendocrine secretory protein 55 (GNAS).	[43]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Neuroendocrine secretory protein 55 (GNAS).	[50]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Neuroendocrine secretory protein 55 (GNAS).	[53]

References

• [1] Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
• [2] GNAS mutations in primary mucinous and non-mucinous lung adenocarcinomas.Mod Pathol. 2017 Dec;30(12):1720-1727. doi: 10.1038/modpathol.2017.88. Epub 2017 Aug 4.
• [3] Selective resistance to parathyroid hormone caused by a novel uncoupling mutation in the carboxyl terminus of G alpha(s). A cause of pseudohypoparathyroidism type Ib. J Biol Chem. 2001 Jan 5;276(1):165-71. doi: 10.1074/jbc.M006032200.
• [4] Depressed heart rate variability and arterial baroreflex in conscious transgenic mice with overexpression of cardiac Gsalpha.Circ Res. 1998 Mar 9;82(4):416-23. doi: 10.1161/01.res.82.4.416.
• [5] Genomic Alterations and Complex Subclonal Architecture in Sporadic GH-Secreting Pituitary Adenomas.J Clin Endocrinol Metab. 2018 May 1;103(5):1929-1939. doi: 10.1210/jc.2017-02287.
• [6] Recurrent activating mutation in PRKACA in cortisol-producing adrenal tumors.Nat Genet. 2014 Jun;46(6):613-7. doi: 10.1038/ng.2956. Epub 2014 Apr 20.
• [7] Identifying recurrent mutations in cancer reveals widespread lineage diversity and mutational specificity.Nat Biotechnol. 2016 Feb;34(2):155-63. doi: 10.1038/nbt.3391. Epub 2015 Nov 30.
• [8] Identification of novel GNAS mutations in intramuscular myxoma using next-generation sequencing with single-molecule tagged molecular inversion probes.Diagn Pathol. 2019 Feb 8;14(1):15. doi: 10.1186/s13000-019-0787-3.
• [9] A multi-dimensional characterization of anxiety in monozygotic twin pairs reveals susceptibility loci in humans.Transl Psychiatry. 2017 Dec 11;7(12):1282. doi: 10.1038/s41398-017-0047-9.
• [10] Genetic variation of the extra-large stimulatory G protein alpha-subunit leads to Gs hyperfunction in platelets and is a risk factor for bleeding.Thromb Haemost. 2001 Sep;86(3):733-8.
• [11] Identification of a mutation in the gene encoding the alpha subunit of the stimulatory G protein of adenylyl cyclase in McCune-Albright syndrome. Proc Natl Acad Sci U S A. 1992 Jun 1;89(11):5152-6. doi: 10.1073/pnas.89.11.5152.
• [12] Exome sequencing of liver fluke-associated cholangiocarcinoma.Nat Genet. 2012 May 6;44(6):690-3. doi: 10.1038/ng.2273.
• [13] Large-Scale Genome-Wide Association Study of East Asians Identifies Loci Associated With Risk for Colorectal Cancer.Gastroenterology. 2019 Apr;156(5):1455-1466. doi: 10.1053/j.gastro.2018.11.066. Epub 2018 Dec 6.
• [14] TSH elevations as the first laboratory evidence for pseudohypoparathyroidism type Ib (PHP-Ib).J Bone Miner Res. 2015 May;30(5):906-12. doi: 10.1002/jbmr.2408.
• [15] Two further AHO-like syndrome patients with deletion of glypican 1 gene region in 2q37.2-q37.3.Int J Mol Med. 2004 Dec;14(6):977-9.
• [16] High throughput molecular profiling reveals differential mutation patterns in intrahepatic cholangiocarcinomas arising in chronic advanced liver diseases.Mod Pathol. 2014 May;27(5):731-9. doi: 10.1038/modpathol.2013.194. Epub 2013 Nov 1.
• [17] Viscoelasticity and histology of the human cartilage in healthy and degenerated conditions of the knee.J Orthop Surg Res. 2019 Aug 13;14(1):256. doi: 10.1186/s13018-019-1308-5.
• [18] GNAS knockdown suppresses osteogenic differentiation of mesenchymal stem cells via activation of Hippo signaling pathway.J Cell Physiol. 2019 Dec;234(12):22299-22310. doi: 10.1002/jcp.28796. Epub 2019 May 30.
• [19] TGR5 contributes to hepatic cystogenesis in rodents with polycystic liver diseases through cyclic adenosine monophosphate/Gs signaling.Hepatology. 2017 Oct;66(4):1197-1218. doi: 10.1002/hep.29284. Epub 2017 Aug 26.
• [20] Progesterone resistance in PCOS endometrium: a microarray analysis in clomiphene citrate-treated and artificial menstrual cycles.J Clin Endocrinol Metab. 2011 Jun;96(6):1737-46. doi: 10.1210/jc.2010-2600. Epub 2011 Mar 16.
• [21] Paternally inherited inactivating mutations of the GNAS1 gene in progressive osseous heteroplasia. N Engl J Med. 2002 Jan 10;346(2):99-106. doi: 10.1056/NEJMoa011262.
• [22] The T393C polymorphism of the GNAS1 gene is associated with deficit schizophrenia in an Italian population sample.Neurosci Lett. 2006 Apr 10-17;397(1-2):159-63. doi: 10.1016/j.neulet.2005.12.028. Epub 2006 Jan 6.
• [23] Changes of the level of G protein alpha-subunit mRNA by tolerance to and withdrawal from pentobarbital in rats.Neurochem Res. 2002 Jun;27(6):527-33. doi: 10.1023/a:1019808905500.
• [24] Association of a GNAS1 gene variant with hypertension and diabetes mellitus.Hypertens Res. 2004 Dec;27(12):919-24. doi: 10.1291/hypres.27.919.
• [25] Demonstration of McCune-Albright mutations in the liver of children with high gammaGT progressive cholestasis.J Hepatol. 2000 Jan;32(1):154-8. doi: 10.1016/s0168-8278(00)80202-0.
• [26] Prevalence of mutations in TSHR, GNAS, PRKAR1A and RAS genes in a large series of toxic thyroid adenomas from Galicia, an iodine-deficient area in NW Spain.Eur J Endocrinol. 2008 Nov;159(5):623-31. doi: 10.1530/EJE-08-0313. Epub 2008 Aug 11.
• [27] Differentiation in neuroblastoma: diffusion-limited hypoxia induces neuro-endocrine secretory protein 55 and other markers of a chromaffin phenotype.PLoS One. 2010 Sep 17;5(9):e12825. doi: 10.1371/journal.pone.0012825.
• [28] The role of germline AIP, MEN1, PRKAR1A, CDKN1B and CDKN2C mutations in causing pituitary adenomas in a large cohort of children, adolescents, and patients with genetic syndromes.Clin Genet. 2010 Nov;78(5):457-63. doi: 10.1111/j.1399-0004.2010.01406.x.
• [29] Inherited variants in genes somatically mutated in thyroid cancer.PLoS One. 2017 Apr 14;12(4):e0174995. doi: 10.1371/journal.pone.0174995. eCollection 2017.
• [30] Screening for GNAS genetic and epigenetic alterations in progressive osseous heteroplasia: first Italian series.Bone. 2013 Oct;56(2):276-80. doi: 10.1016/j.bone.2013.06.015. Epub 2013 Jun 21.
• [31] The diagnostic utility of the GNAS mutation in patients with fibrous dysplasia: meta-analysis of 168 sporadic cases.Hum Pathol. 2012 Aug;43(8):1234-42. doi: 10.1016/j.humpath.2011.09.012. Epub 2012 Jan 14.
• [32] Genetic diseases associated with heterotrimeric G proteins.Trends Pharmacol Sci. 2006 May;27(5):260-6. doi: 10.1016/j.tips.2006.03.005. Epub 2006 Apr 5.
• [33] Genetic and Epigenetic Defects at the GNAS Locus Lead to Distinct Patterns of Skeletal Growth but Similar Early-Onset Obesity.J Bone Miner Res. 2018 Aug;33(8):1480-1488. doi: 10.1002/jbmr.3450. Epub 2018 Jun 7.
• [34] Mutational analysis of high-grade spindle cell sarcoma of the femur in Mazabraud's syndrome.Skeletal Radiol. 2019 Jan;48(1):151-157. doi: 10.1007/s00256-018-2975-8. Epub 2018 May 27.
• [35] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [36] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [37] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [38] Expression Profiling of Human Pluripotent Stem Cell-Derived Cardiomyocytes Exposed to Doxorubicin-Integration and Visualization of Multi-Omics Data. Toxicol Sci. 2018 May 1;163(1):182-195. doi: 10.1093/toxsci/kfy012.
• [39] Identification of estrogen-induced genes downregulated by AhR agonists in MCF-7 breast cancer cells using suppression subtractive hybridization. Gene. 2001 Jan 10;262(1-2):207-14. doi: 10.1016/s0378-1119(00)00530-8.
• [40] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [41] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [42] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [43] Pregnancy exposure to synthetic phenols and placental DNA methylation - An epigenome-wide association study in male infants from the EDEN cohort. Environ Pollut. 2021 Dec 1;290:118024. doi: 10.1016/j.envpol.2021.118024. Epub 2021 Aug 21.
• [44] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [45] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [46] High levels of caveolar cholesterol inhibit progesterone-induced genomic actions in human and guinea pig gallbladder muscle. Am J Physiol Gastrointest Liver Physiol. 2009 Apr;296(4):G948-54. doi: 10.1152/ajpgi.90699.2008. Epub 2009 Feb 12.
• [47] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [48] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [49] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [50] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [51] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [52] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [53] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [54] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [55] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [56] BAD phosphorylation determines ovarian cancer chemosensitivity and patient survival. Clin Cancer Res. 2011 Oct 1;17(19):6356-66. doi: 10.1158/1078-0432.CCR-11-0735. Epub 2011 Aug 17.
• [57] Identification of specific ligands for orphan olfactory receptors. G protein-dependent agonism and antagonism of odorants. J Biol Chem. 2005 Mar 25;280(12):11807-15. doi: 10.1074/jbc.M411508200. Epub 2004 Dec 14.
• [58] Effect of 393T>C polymorphism of GNAS1 gene on dobutamine response in Chinese healthy subjects. J Clin Pharmacol. 2009 Aug;49(8):929-36. doi: 10.1177/0091270009337945. Epub 2009 Jun 19.