Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRP1MFC)

• DOT Name: Retinol-binding protein 1 (RBP1)
• Synonyms: Cellular retinol-binding protein; CRBP; Cellular retinol-binding protein I; CRBP-I
• Gene Name: RBP1
• Related Disease:
  Carcinoma
  Cervical cancer
  Cervical carcinoma
  Endometrial cancer
  Endometrial carcinoma
  Adenocarcinoma
  Barrett esophagus
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Clear cell renal carcinoma
  Cystic fibrosis
  Endometriosis
  Epithelial ovarian cancer
  Glioma
  Hepatocellular carcinoma
  Leiomyoma
  Liver cirrhosis
  Malignant soft tissue neoplasm
  Melanoma
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic cancer
  Prostate carcinoma
  Psoriasis
  Renal cell carcinoma
  Retinoblastoma
  Sarcoma
  Schizophrenia
  Squamous cell carcinoma
  Thyroid tumor
  Urinary bladder cancer
  Urinary bladder neoplasm
  Uterine fibroids
  Nasopharyngeal carcinoma
  Prostate cancer
  Acute myelogenous leukaemia
  Adult lymphoma
  Advanced cancer
  Breast neoplasm
  Fetal growth restriction
  Gastric cancer
  Gastric neoplasm
  Hereditary diffuse gastric adenocarcinoma
  Lymphoma
  Pediatric lymphoma
  Undifferentiated carcinoma
• UniProt ID: RET1_HUMAN
• PDB ID: 5H8T; 5H9A; 5HA1; 5HBS; 5LJB; 5LJC; 5LJD; 5LJE; 5LJG; 5LJH; 5LJK; 6E5L; 6E5T; 6E6M; 8GD2; 8GDM; 8GEM; 8GEU; 8GEV; 8GEY
• Pfam ID: PF00061
• Sequence:
  MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRN
  YIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEM
  RVEGVVCKQVFKKVQ
• Function: Cytoplasmic retinol-binding protein. Accepts retinol from the transport protein STRA6, and thereby contributes to retinol uptake, storage and retinoid homeostasis.
• Tissue Specificity: Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver.
• Reactome Pathway:
  The canonical retinoid cycle in rods (twilight vision) (R-HSA-2453902)
  Retinoid metabolism and transport (R-HSA-975634)
  Retinoid cycle disease events (R-HSA-2453864)
• BioCyc Pathway: MetaCyc:ENSG00000114115-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma	DISH9F1N	Definitive	Biomarker	[1]
Cervical cancer	DISFSHPF	Definitive	Altered Expression	[2]
Cervical carcinoma	DIST4S00	Definitive	Altered Expression	[2]
Endometrial cancer	DISW0LMR	Definitive	Biomarker	[3]
Endometrial carcinoma	DISXR5CY	Definitive	Biomarker	[3]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[4]
Barrett esophagus	DIS416Y7	Strong	Biomarker	[5]
Bladder cancer	DISUHNM0	Strong	Posttranslational Modification	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[8]
Cystic fibrosis	DIS2OK1Q	Strong	Altered Expression	[9]
Endometriosis	DISX1AG8	Strong	Altered Expression	[10]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[7]
Glioma	DIS5RPEH	Strong	Biomarker	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[12]
Leiomyoma	DISLDDFN	Strong	Altered Expression	[13]
Liver cirrhosis	DIS4G1GX	Strong	Altered Expression	[14]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Biomarker	[15]
Melanoma	DIS1RRCY	Strong	Altered Expression	[16]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[7]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[7]
Pancreatic cancer	DISJC981	Strong	Altered Expression	[17]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[7]
Psoriasis	DIS59VMN	Strong	Biomarker	[18]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[8]
Retinoblastoma	DISVPNPB	Strong	Biomarker	[19]
Sarcoma	DISZDG3U	Strong	Biomarker	[15]
Schizophrenia	DISSRV2N	Strong	Biomarker	[20]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[21]
Thyroid tumor	DISLVKMD	Strong	Altered Expression	[22]
Urinary bladder cancer	DISDV4T7	Strong	Posttranslational Modification	[6]
Urinary bladder neoplasm	DIS7HACE	Strong	Posttranslational Modification	[6]
Uterine fibroids	DISBZRMJ	Strong	Altered Expression	[23]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Biomarker	[24]
Prostate cancer	DISF190Y	Disputed	Altered Expression	[7]
Acute myelogenous leukaemia	DISCSPTN	Limited	Altered Expression	[25]
Adult lymphoma	DISK8IZR	Limited	Biomarker	[26]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[27]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[26]
Fetal growth restriction	DIS5WEJ5	Limited	Biomarker	[28]
Gastric cancer	DISXGOUK	Limited	Biomarker	[29]
Gastric neoplasm	DISOKN4Y	Limited	Biomarker	[29]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Limited	Biomarker	[29]
Lymphoma	DISN6V4S	Limited	Biomarker	[26]
Pediatric lymphoma	DIS51BK2	Limited	Biomarker	[26]
Undifferentiated carcinoma	DISIAZST	Limited	Biomarker	[30]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Progesterone	DMUY35B	Approved	Retinol-binding protein 1 (RBP1) increases the Hormone level abnormal ADR of Progesterone.	[60]
Paclitaxel	DMLB81S	Approved	Retinol-binding protein 1 (RBP1) increases the response to substance of Paclitaxel.	[61]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Retinol-binding protein 1 (RBP1).	[31]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Retinol-binding protein 1 (RBP1).	[50]

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Retinol-binding protein 1 (RBP1).	[32]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Retinol-binding protein 1 (RBP1).	[33]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Retinol-binding protein 1 (RBP1).	[34]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Retinol-binding protein 1 (RBP1).	[35]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Retinol-binding protein 1 (RBP1).	[36]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Retinol-binding protein 1 (RBP1).	[37]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Retinol-binding protein 1 (RBP1).	[38]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Retinol-binding protein 1 (RBP1).	[39]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Retinol-binding protein 1 (RBP1).	[40]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Retinol-binding protein 1 (RBP1).	[41]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Retinol-binding protein 1 (RBP1).	[43]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Retinol-binding protein 1 (RBP1).	[40]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Retinol-binding protein 1 (RBP1).	[44]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Retinol-binding protein 1 (RBP1).	[45]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol decreases the expression of Retinol-binding protein 1 (RBP1).	[46]
Vitamin A	DMJ2AH4	Approved	Vitamin A increases the expression of Retinol-binding protein 1 (RBP1).	[47]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Retinol-binding protein 1 (RBP1).	[48]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Retinol-binding protein 1 (RBP1).	[44]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Retinol-binding protein 1 (RBP1).	[49]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Retinol-binding protein 1 (RBP1).	[51]
PMID27336223-Compound-5	DM6E50A	Patented	PMID27336223-Compound-5 increases the expression of Retinol-binding protein 1 (RBP1).	[45]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Retinol-binding protein 1 (RBP1).	[52]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Retinol-binding protein 1 (RBP1).	[53]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Retinol-binding protein 1 (RBP1).	[54]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Retinol-binding protein 1 (RBP1).	[55]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Retinol-binding protein 1 (RBP1).	[56]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Retinol-binding protein 1 (RBP1).	[57]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Retinol-binding protein 1 (RBP1).	[58]
Fibrates	DMFNTMY	Investigative	Fibrates decreases the expression of Retinol-binding protein 1 (RBP1).	[59]

1 Drug(s) Affected the Biochemical Pathways of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Decitabine	DMQL8XJ	Approved	Decitabine decreases the metabolism of Retinol-binding protein 1 (RBP1).	[42]

References

• [1] CRBP-1 expression in ovarian cancer: a potential therapeutic target.Anticancer Res. 2014 Jul;34(7):3303-12.
• [2] Cellular retinol binding protein 1 could be a tumor suppressor gene in cervical cancer.Int J Clin Exp Pathol. 2013 Aug 15;6(9):1817-25. eCollection 2013.
• [3] Cellular retinol binding protein-1 expression in endometrial hyperplasia and carcinoma: diagnostic and possible therapeutic implications.Mod Pathol. 2006 Jun;19(6):797-803. doi: 10.1038/modpathol.3800586.
• [4] Aberrant cellular retinol binding protein 1 (CRBP1) gene expression and promoter methylation in prostate cancer.J Clin Pathol. 2004 Aug;57(8):872-6. doi: 10.1136/jcp.2003.014555.
• [5] Similarity of aberrant DNA methylation in Barrett's esophagus and esophageal adenocarcinoma.Mol Cancer. 2008 Oct 2;7:75. doi: 10.1186/1476-4598-7-75.
• [6] CpG hypermethylation of cellular retinol-binding protein 1 contributes to cell proliferation and migration in bladder cancer.Int J Oncol. 2010 Dec;37(6):1379-88. doi: 10.3892/ijo_00000789.
• [7] CRBP-1 over-expression is associated with poor prognosis in tongue squamous cell carcinoma.BMC Cancer. 2018 May 2;18(1):514. doi: 10.1186/s12885-018-4249-1.
• [8] Cellular retinoic acid binding protein I: expression and functional influence in renal cell carcinoma. Tumour Biol. 2005 Nov-Dec;26(6):313-23. doi: 10.1159/000089262. Epub 2005 Oct 25.
• [9] Retinoic acid receptors alpha, beta and gamma, and cellular retinol binding protein-I expression in breast fibrocystic disease and cancer.Eur J Endocrinol. 1997 Oct;137(4):410-4. doi: 10.1530/eje.0.1370410.
• [10] Retinoic acid biosynthesis is impaired in human and murine endometriosis.Biol Reprod. 2014 Oct;91(4):84. doi: 10.1095/biolreprod.114.119677. Epub 2014 Aug 20.
• [11] Identification of retinol binding protein 1 promoter hypermethylation in isocitrate dehydrogenase 1 and 2 mutant gliomas.J Natl Cancer Inst. 2012 Oct 3;104(19):1458-69. doi: 10.1093/jnci/djs357. Epub 2012 Sep 3.
• [12] Cellular retinol-binding protein-1 in hepatocellular carcinoma correlates with beta-catenin, Ki-67 index, and patient survival.Hepatology. 2003 Aug;38(2):470-80. doi: 10.1053/jhep.2003.50321.
• [13] Retinoids regulate genes involved in retinoic acid synthesis and transport in human myometrial and fibroid smooth muscle cells.Hum Reprod. 2008 May;23(5):1076-86. doi: 10.1093/humrep/den083. Epub 2008 Mar 13.
• [14] Cellular retinol-binding protein-1 expression in normal and fibrotic/cirrhotic human liver: different patterns of expression in hepatic stellate cells and (myo)fibroblast subpopulations.J Hepatol. 2004 May;40(5):774-80. doi: 10.1016/j.jhep.2004.01.008.
• [15] Cellular retinol-binding protein I, a regulator of breast epithelial retinoic acid receptor activity, cell differentiation, and tumorigenicity.J Natl Cancer Inst. 2005 Jan 5;97(1):21-9. doi: 10.1093/jnci/dji004.
• [16] Human melanomas of fibroblast and epithelial morphology differ widely in their ability to synthesize retinyl esters.Carcinogenesis. 2002 Nov;23(11):1821-30. doi: 10.1093/carcin/23.11.1821.
• [17] Retinoid signaling in pancreatic cancer, injury and regeneration.PLoS One. 2011;6(12):e29075. doi: 10.1371/journal.pone.0029075. Epub 2011 Dec 29.
• [18] Expression and potential role of cellular retinol binding protein I in psoriasis.Oncotarget. 2018 Dec 4;9(95):36736-36749. doi: 10.18632/oncotarget.26314. eCollection 2018 Dec 4.
• [19] Bdp, a new member of a family of DNA-binding proteins, associates with the retinoblastoma gene product.Cancer Res. 1999 Aug 1;59(15):3741-7.
• [20] A genome-wide association study in 574 schizophrenia trios using DNA pooling.Mol Psychiatry. 2009 Aug;14(8):796-803. doi: 10.1038/mp.2008.33. Epub 2008 Mar 11.
• [21] The Ki67+ proliferation index correlates with increased cellular retinol-binding protein-1 and the coordinated loss of plakophilin-1 and desmoplakin during progression of cervical squamous lesions.Histopathology. 2007 Jul;51(1):87-97. doi: 10.1111/j.1365-2559.2007.02724.x.
• [22] Retinoid acid receptor expression is helpful to distinguish between adenoma and well-differentiated carcinoma in the thyroid.Virchows Arch. 2013 Jun;462(6):619-32. doi: 10.1007/s00428-013-1419-z. Epub 2013 May 4.
• [23] Uterine leiomyomas express a molecular pattern that lowers retinoic acid exposure.Fertil Steril. 2007 Jun;87(6):1388-98. doi: 10.1016/j.fertnstert.2006.11.093. Epub 2007 Feb 2.
• [24] Epigenetic silencing of cellular retinol-binding proteins in nasopharyngeal carcinoma.Neoplasia. 2005 Jan;7(1):67-74. doi: 10.1593/neo.04370.
• [25] The expression of cellular retinoid binding proteins in non-APL leukemic cells and its association with retinoid sensitivity.Leuk Lymphoma. 2002 Apr;43(4):851-8. doi: 10.1080/10428190290016999.
• [26] Hypermethylation-associated Inactivation of the Cellular Retinol-Binding-Protein 1 Gene in Human Cancer.Cancer Res. 2002 Oct 15;62(20):5902-5.
• [27] Vitamin A, cancer treatment and prevention: the new role of cellular retinol binding proteins.Biomed Res Int. 2015;2015:624627. doi: 10.1155/2015/624627. Epub 2015 Mar 24.
• [28] Placental Stem Villus Arterial Remodeling Associated with Reduced Hydrogen Sulfide Synthesis Contributes to Human Fetal Growth Restriction.Am J Pathol. 2017 Apr;187(4):908-920. doi: 10.1016/j.ajpath.2016.12.002. Epub 2017 Feb 1.
• [29] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
• [30] cDNA microarray profiling of rat mammary gland carcinomas induced by 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine and 7,12-dimethylbenz[a]anthracene.Carcinogenesis. 2002 Oct;23(10):1561-8. doi: 10.1093/carcin/23.10.1561.
• [31] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [32] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [33] The retinoid anticancer signal: mechanisms of target gene regulation. Br J Cancer. 2005 Aug 8;93(3):310-8. doi: 10.1038/sj.bjc.6602700.
• [34] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [35] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [36] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [37] Characterisation of cisplatin-induced transcriptomics responses in primary mouse hepatocytes, HepG2 cells and mouse embryonic stem cells shows conservation of regulating transcription factor networks. Mutagenesis. 2014 Jan;29(1):17-26.
• [38] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [39] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [40] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [41] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [42] A repressive epigenetic domino effect confers susceptibility to breast epithelial cell transformation: implications for predicting breast cancer risk. Cancer Res. 2006 Nov 1;66(21):10308-14. doi: 10.1158/0008-5472.CAN-06-1052.
• [43] Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
• [44] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
• [45] PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
• [46] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [47] Molecular and metabolic retinoid pathways in human amniotic membranes. Biochem Biophys Res Commun. 2006 Aug 11;346(4):1207-16. doi: 10.1016/j.bbrc.2006.06.024. Epub 2006 Jun 12.
• [48] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [49] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [50] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [51] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [52] Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
• [53] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [54] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [55] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [56] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [57] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [58] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [59] Decrease of hepatic stellate cells in rats with enhanced sensitivity to clofibrate-induced hepatocarcinogenesis. Cancer Sci. 2011 Apr;102(4):735-41. doi: 10.1111/j.1349-7006.2011.01856.x. Epub 2011 Feb 10.
• [60] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
• [61] Gene expression analysis using human cancer xenografts to identify novel predictive marker genes for the efficacy of 5-fluorouracil-based drugs. Cancer Sci. 2006 Jun;97(6):510-22. doi: 10.1111/j.1349-7006.2006.00204.x.