Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTX7WGYN)

• DOT Name: Hematopoietic lineage cell-specific protein (HCLS1)
• Synonyms: Hematopoietic cell-specific LYN substrate 1; LckBP1; p75
• Gene Name: HCLS1
• Related Disease:
  Cerebral infarction
  Glioma
  Acute leukaemia
  Alzheimer disease
  Amyotrophic lateral sclerosis
  Atopic dermatitis
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Classic Hodgkin lymphoma
  Depression
  Epilepsy
  Epithelial ovarian cancer
  Fibrosarcoma
  Huntington disease
  Major depressive disorder
  Malignant glioma
  Matthew-Wood syndrome
  Neuroblastoma
  Osteoarthritis
  Pancreatic ductal carcinoma
  Parkinson disease
  Retinoblastoma
  Rheumatoid arthritis
  Severe congenital neutropenia
  Small lymphocytic lymphoma
  Squamous cell carcinoma
  Systemic lupus erythematosus
  T-cell leukaemia
  Triple negative breast cancer
  Type-1/2 diabetes
  Medulloblastoma
  Cognitive impairment
  Acute myelogenous leukaemia
  Ankylosing spondylitis
  Arrhythmia
  Arthritis
  Esophageal squamous cell carcinoma
  Hyperglycemia
  Hyperinsulinemia
  Melanoma
  Myeloid leukaemia
  Nervous system disease
  Prostate cancer
  Prostate carcinoma
• UniProt ID: HCLS1_HUMAN
• Pfam ID: PF02218 ; PF00018
• Sequence:
  MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNK
  VSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGF
  GGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGE
  TEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKA
  KFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISS
  EAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVY
  EAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPA
  GAGAGAVALGISAVAVYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPAN
  YVKLLE
• Function: Substrate of the antigen receptor-coupled tyrosine kinase. Plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells. May also be involved in the regulation of gene expression.
• Tissue Specificity: Expressed only in tissues and cells of hematopoietic origin.
• KEGG Pathway:
  Tight junction (hsa04530)
  Bacterial invasion of epithelial cells (hsa05100)
  Pathogenic Escherichia coli infection (hsa05130)
  Shigellosis (hsa05131)
  Proteoglycans in cancer (hsa05205)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cerebral infarction	DISR1WNP	Definitive	Altered Expression	[1]
Glioma	DIS5RPEH	Definitive	Biomarker	[2]
Acute leukaemia	DISDQFDI	Strong	Altered Expression	[3]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[4]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Biomarker	[5]
Atopic dermatitis	DISTCP41	Strong	Altered Expression	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[8]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[9]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[10]
Depression	DIS3XJ69	Strong	Genetic Variation	[11]
Epilepsy	DISBB28L	Strong	Altered Expression	[12]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[13]
Fibrosarcoma	DISWX7MU	Strong	Altered Expression	[14]
Huntington disease	DISQPLA4	Strong	Biomarker	[15]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[16]
Malignant glioma	DISFXKOV	Strong	Altered Expression	[17]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[18]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[19]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[20]
Pancreatic ductal carcinoma	DIS26F9Q	Strong	Altered Expression	[18]
Parkinson disease	DISQVHKL	Strong	Biomarker	[21]
Retinoblastoma	DISVPNPB	Strong	Altered Expression	[22]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[23]
Severe congenital neutropenia	DISES99N	Strong	Genetic Variation	[24]
Small lymphocytic lymphoma	DIS30POX	Strong	Altered Expression	[25]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[26]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[27]
T-cell leukaemia	DISJ6YIF	Strong	Biomarker	[28]
Triple negative breast cancer	DISAMG6N	Strong	Altered Expression	[29]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[30]
Medulloblastoma	DISZD2ZL	moderate	Biomarker	[31]
Cognitive impairment	DISH2ERD	Disputed	Biomarker	[32]
Acute myelogenous leukaemia	DISCSPTN	Limited	Altered Expression	[33]
Ankylosing spondylitis	DISRC6IR	Limited	Genetic Variation	[34]
Arrhythmia	DISFF2NI	Limited	Biomarker	[35]
Arthritis	DIST1YEL	Limited	Genetic Variation	[36]
Esophageal squamous cell carcinoma	DIS5N2GV	Limited	Altered Expression	[37]
Hyperglycemia	DIS0BZB5	Limited	Biomarker	[38]
Hyperinsulinemia	DISIDWT6	Limited	Biomarker	[38]
Melanoma	DIS1RRCY	Limited	Biomarker	[39]
Myeloid leukaemia	DISMN944	Limited	Biomarker	[40]
Nervous system disease	DISJ7GGT	Limited	Biomarker	[41]
Prostate cancer	DISF190Y	Limited	Altered Expression	[42]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[42]

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Hematopoietic lineage cell-specific protein (HCLS1) affects the response to substance of Doxorubicin.	[55]
Mitomycin	DMH0ZJE	Approved	Hematopoietic lineage cell-specific protein (HCLS1) affects the response to substance of Mitomycin.	[55]
Vinblastine	DM5TVS3	Approved	Hematopoietic lineage cell-specific protein (HCLS1) affects the response to substance of Vinblastine.	[55]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Hematopoietic lineage cell-specific protein (HCLS1).	[43]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Hematopoietic lineage cell-specific protein (HCLS1).	[44]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Hematopoietic lineage cell-specific protein (HCLS1).	[45]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Hematopoietic lineage cell-specific protein (HCLS1).	[46]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Hematopoietic lineage cell-specific protein (HCLS1).	[47]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Hematopoietic lineage cell-specific protein (HCLS1).	[48]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Hematopoietic lineage cell-specific protein (HCLS1).	[49]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Hematopoietic lineage cell-specific protein (HCLS1).	[50]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Hematopoietic lineage cell-specific protein (HCLS1).	[51]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Hematopoietic lineage cell-specific protein (HCLS1).	[52]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Hematopoietic lineage cell-specific protein (HCLS1).	[53]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Hematopoietic lineage cell-specific protein (HCLS1).	[54]

References

• [1] Upregulation of p75 neurotrophin receptor after stroke in mice does not contribute to differential vulnerability of striatal neurons.Exp Neurol. 2001 Jun;169(2):351-63. doi: 10.1006/exnr.2001.7646.
• [2] The p75 neurotrophin receptor enhances HIF-dependent signaling in glioma.Exp Cell Res. 2018 Oct 1;371(1):122-129. doi: 10.1016/j.yexcr.2018.08.002. Epub 2018 Aug 6.
• [3] Expression of the p75 neurotrophin receptor in acute leukaemia.Br J Haematol. 2005 Oct;131(1):67-70. doi: 10.1111/j.1365-2141.2005.05717.x.
• [4] Neurotrophin Receptor p75 mRNA Level in Peripheral Blood Cells of Patients with Alzheimer's Disease.Neurotox Res. 2019 Jul;36(1):101-107. doi: 10.1007/s12640-019-00035-9. Epub 2019 Apr 11.
• [5] Urinary p75(ECD): A prognostic, disease progression, and pharmacodynamic biomarker in ALS.Neurology. 2017 Mar 21;88(12):1137-1143. doi: 10.1212/WNL.0000000000003741. Epub 2017 Feb 22.
• [6] Autoantibodies to DFS 70 kd/transcription coactivator p75 in atopic dermatitis and other conditions.J Allergy Clin Immunol. 2000 Jun;105(6 Pt 1):1211-20. doi: 10.1067/mai.2000.107039.
• [7] Transgenic mice expressing the p75 CCAAT-displacement protein/Cut homeobox isoform develop a myeloproliferative disease-like myeloid leukemia.Cancer Res. 2006 Oct 1;66(19):9492-501. doi: 10.1158/0008-5472.CAN-05-4230.
• [8] Altered expression and activation of the nerve growth factor receptors TrkA and p75 provide the first evidence of tumor progression to effusion in breast carcinoma.Breast Cancer Res Treat. 2004 Jan;83(2):119-28. doi: 10.1023/B:BREA.0000010704.17479.8a.
• [9] Mouse mammary tumor virus p75 and p110 CUX1 transgenic mice develop mammary tumors of various histologic types.Cancer Res. 2009 Sep 15;69(18):7188-97. doi: 10.1158/0008-5472.CAN-08-4899. Epub 2009 Sep 8.
• [10] Expression of p55 (Tac) interleukin-2 receptor (IL-2R), but not p75 IL-2R, in cultured H-RS cells and H-RS cells in tissues.Am J Pathol. 1990 Apr;136(4):735-44.
• [11] Single-nucleotide polymorphisms in TrkB and risk for depression: findings from the women's interagency HIV study.J Acquir Immune Defic Syndr. 2013 Oct 1;64(2):138-41. doi: 10.1097/QAI.0b013e3182a468e9.
• [12] The transmembrane domain of the p75 neurotrophin receptor stimulates phosphorylation of the TrkB tyrosine kinase receptor.J Biol Chem. 2017 Oct 6;292(40):16594-16604. doi: 10.1074/jbc.M117.788729. Epub 2017 Aug 17.
• [13] Hematopoietic lineage cell-specific protein 1 immunoreactivity indicates an increased risk of poor overall survival in patients with ovarian carcinoma.Oncol Lett. 2018 Jun;15(6):9406-9412. doi: 10.3892/ol.2018.8493. Epub 2018 Apr 13.
• [14] Cytotoxicity in L929 murine fibrosarcoma cells after triggering of transfected human p75 tumour necrosis factor (TNF) receptor is mediated by endogenous murine TNF.Cytokine. 1995 Jul;7(5):463-70. doi: 10.1006/cyto.1995.0063.
• [15] A small molecule TrkB ligand reduces motor impairment and neuropathology in R6/2 and BACHD mouse models of Huntington's disease.J Neurosci. 2013 Nov 27;33(48):18712-27. doi: 10.1523/JNEUROSCI.1310-13.2013.
• [16] Combined serum levels of multiple proteins in tPA-BDNF pathway may aid the diagnosis of five mental disorders.Sci Rep. 2017 Jul 31;7(1):6871. doi: 10.1038/s41598-017-06832-6.
• [17] ProBDNF and its receptors are upregulated in glioma and inhibit the growth of glioma cells in vitro.Neuro Oncol. 2013 Aug;15(8):990-1007. doi: 10.1093/neuonc/not039. Epub 2013 Apr 10.
• [18] Reverse transcription-PCR analysis of laser-captured cells points to potential paracrine and autocrine actions of neurotrophins in pancreatic cancer.Clin Cancer Res. 2003 Nov 1;9(14):5127-36.
• [19] p75 neurotrophin receptor and fenretinide-induced signaling in neuroblastoma.Cancer Chemother Pharmacol. 2014 Feb;73(2):271-9. doi: 10.1007/s00280-013-2355-y. Epub 2013 Nov 20.
• [20] Enhanced expression of tumor necrosis factor receptor mRNA and protein in mononuclear cells isolated from rheumatoid arthritis synovial joints.Eur J Immunol. 1992 Jul;22(7):1907-12. doi: 10.1002/eji.1830220734.
• [21] Genetic Association Between NGFR, ADAM17 Gene Polymorphism, and Parkinson's Disease in the Chinese Han Population.Neurotox Res. 2019 Oct;36(3):463-471. doi: 10.1007/s12640-019-00031-z. Epub 2019 Apr 2.
• [22] Neurotrophin receptor expression in human primary retinoblastomas and retinoblastoma cell lines.Pediatr Blood Cancer. 2008 Feb;50(2):218-22. doi: 10.1002/pbc.21369.
• [23] From transcriptome to proteome: differentially expressed proteins identified in synovial tissue of patients suffering from rheumatoid arthritis and osteoarthritis by an initial screen with a panel of 791 antibodies.Proteomics. 2003 Jun;3(6):991-1002. doi: 10.1002/pmic.200300412.
• [24] In vitro study of HAX1 gene therapy by retro viral transduction as a therapeutic target in severe congenital neutropenia.Eur Cytokine Netw. 2018 Nov 1;29(4):146-152. doi: 10.1684/ecn.2018.0419.
• [25] High expression of hematopoietic cell specific Lyn substrate-1 (HS1) predicts poor survival of B-cell chronic lymphocytic leukemia patients.Leuk Res. 2012 Jul;36(7):876-80. doi: 10.1016/j.leukres.2012.01.017. Epub 2012 Feb 12.
• [26] p75 Nerve Growth Factor Receptor as a Specific Nerve Marker in the Diagnosis of Perineural Invasion of Squamous Cell Carcinoma.Am J Clin Pathol. 2019 May 3;151(6):574-583. doi: 10.1093/ajcp/aqz011.
• [27] Association of a four-amino acid residue insertion polymorphism of the HS1 gene with systemic lupus erythematosus: molecular and functional analysis.Arthritis Rheum. 2004 Mar;50(3):871-81. doi: 10.1002/art.20192.
• [28] Immunomodulatory effects of RXR rexinoids: modulation of high-affinity IL-2R expression enhances susceptibility to denileukin diftitox.Blood. 2002 Aug 15;100(4):1399-403. doi: 10.1182/blood-2002-01-0300.
• [29] Inhibition of Triple-Negative Breast Cancer Tumor Growth by Electroacupuncture with Encircled Needling and Its Mechanisms in a Mice Xenograft Model.Int J Med Sci. 2019 Nov 9;16(12):1642-1651. doi: 10.7150/ijms.38521. eCollection 2019.
• [30] Modulation of the p75 neurotrophin receptor using LM11A-31 prevents diabetes-induced retinal vascular permeability in mice via inhibition of inflammation and the RhoA kinase pathway. Diabetologia. 2019 Aug;62(8):1488-1500.
• [31] Neurotrophin receptors and heparanase: a functional axis in human medulloblastoma invasion.J Exp Clin Cancer Res. 2007 Mar;26(1):5-23.
• [32] A small molecule p75NTR ligand, LM11A-31, reverses cholinergic neurite dystrophy in Alzheimer's disease mouse models with mid- to late-stage disease progression.PLoS One. 2014 Aug 25;9(8):e102136. doi: 10.1371/journal.pone.0102136. eCollection 2014.
• [33] Alpha (p55) and beta (p75) chains of the interleukin-2 receptor are expressed by AML blasts.Leukemia. 1993 Mar;7(3):418-25.
• [34] Both baseline clinical factors and genetic polymorphisms influence the development of severe functional status in ankylosing spondylitis.PLoS One. 2012;7(9):e43428. doi: 10.1371/journal.pone.0043428. Epub 2012 Sep 12.
• [35] Transient denervation of viable myocardium after myocardial infarction does not alter arrhythmia susceptibility.Am J Physiol Heart Circ Physiol. 2018 Mar 1;314(3):H415-H423. doi: 10.1152/ajpheart.00300.2017. Epub 2017 Nov 3.
• [36] Soluble human p55 and p75 tumor necrosis factor receptors reverse spontaneous arthritis in transgenic mice expressing transmembrane tumor necrosis factor alpha.Arthritis Rheum. 2006 Sep;54(9):2872-85. doi: 10.1002/art.22077.
• [37] Flow Cytometric Detection of Circulating Tumor Cells Using a Candidate Stem Cell Marker, p75 Neurotrophin Receptor (p75NTR).Methods Mol Biol. 2017;1634:211-217. doi: 10.1007/978-1-4939-7144-2_18.
• [38] Mechanisms of TNF-alpha-induced insulin resistance.Exp Clin Endocrinol Diabetes. 1999;107(2):119-25. doi: 10.1055/s-0029-1212086.
• [39] Apoptosis related protein-1 triggers melanoma cell death via interaction with the juxtamembrane region of p75 neurotrophin receptor.J Cell Mol Med. 2012 Feb;16(2):349-61. doi: 10.1111/j.1582-4934.2011.01304.x.
• [40] Proteolytic processing of cut homeobox 1 by neutrophil elastase in the MV4;11 myeloid leukemia cell line.Mol Cancer Res. 2008 Apr;6(4):644-53. doi: 10.1158/1541-7786.MCR-07-0268.
• [41] The p75 neurotrophin receptor regulates cranial irradiation-induced hippocampus-dependent cognitive dysfunction.Oncotarget. 2017 Jun 20;8(25):40544-40557. doi: 10.18632/oncotarget.16492.
• [42] Tyrosine kinase inhibitor CEP-701 blocks the NTRK1/NGF receptor and limits the invasive capability of prostate cancer cells in vitro.Int J Oncol. 2007 Jan;30(1):193-200.
• [43] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [44] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [45] Arsenic alters transcriptional responses to Pseudomonas aeruginosa infection and decreases antimicrobial defense of human airway epithelial cells. Toxicol Appl Pharmacol. 2017 Sep 15;331:154-163.
• [46] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [47] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [48] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [49] Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.
• [50] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [51] Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
• [52] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [53] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [54] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [55] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.