Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY01V9G)

• DOT Name: Cellular retinoic acid-binding protein 2 (CRABP2)
• Synonyms: Cellular retinoic acid-binding protein II; CRABP-II
• Gene Name: CRABP2
• Related Disease:
  Adenocarcinoma
  Astrocytoma
  Familial hypercholesterolemia
  Hypercholesterolemia, familial, 1
  Non-insulin dependent diabetes
  Advanced cancer
  Bone osteosarcoma
  Breast carcinoma
  Breast neoplasm
  Clear cell renal carcinoma
  Endometriosis
  Esophageal squamous cell carcinoma
  Head-neck squamous cell carcinoma
  Hepatitis C virus infection
  Immunodeficiency
  Invasive ductal breast carcinoma
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Malignant peripheral nerve sheath tumor
  Matthew-Wood syndrome
  Medulloblastoma
  Melanoma
  Neoplasm
  Neuroblastoma
  Non-small-cell lung cancer
  Osteosarcoma
  Pancreatic ductal carcinoma
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Rheumatoid arthritis
  Squamous cell carcinoma
  Thyroid gland undifferentiated (anaplastic) carcinoma
  Wilms tumor
  Breast cancer
  Carcinoma
  Lung adenocarcinoma
  Neurofibromatosis type 1
  Neural tube defect
  Atopic dermatitis
  Childhood kidney Wilms tumor
  Metastatic malignant neoplasm
  Methylmalonic acidemia
  Skin disease
• UniProt ID: RABP2_HUMAN
• PDB ID: 1BLR ; 1BM5 ; 1CBQ ; 1CBS ; 1XCA ; 2CBS ; 2FR3 ; 2FRS ; 2FS6 ; 2FS7 ; 2G78 ; 2G79 ; 2G7B ; 3CBS ; 3CR6 ; 3CWK ; 3D95 ; 3D96 ; 3D97 ; 3F8A ; 3F9D ; 3FA6 ; 3FA7 ; 3FA8 ; 3FA9 ; 3FEK ; 3FEL ; 3FEN ; 3FEP ; 3I17 ; 4I9R ; 4I9S ; 4M6S ; 4M7M ; 4QGV ; 4QGW ; 4QGX ; 4YBP ; 4YBU ; 4YCE ; 4YCH ; 4YDA ; 4YDB ; 4YFP ; 4YFQ ; 4YFR ; 4YGG ; 4YGH ; 4YGZ ; 4YH0 ; 4YKM ; 4YKO ; 5HZQ ; 5OGB ; 6HKR ; 6MOP ; 6MOQ ; 6MOR ; 6MOV ; 6MOW ; 6MOX ; 6MPK ; 6MQI ; 6MQJ ; 6MQW ; 6MQX ; 6MQY ; 6MQZ ; 6MR0 ; 6NNX ; 6NNY ; 6NOE ; 6Z2U ; 6Z2Z ; 6ZSW ; 6ZSX ; 7AA0 ; 7AA1 ; 7OXW ; 7OXX ; 7RY5
• Pfam ID: PF00061
• Sequence:
  MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVR
  TTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGEL
  ILTMTADDVVCTRVYVRE
• Function: Transports retinoic acid to the nucleus. Regulates the access of retinoic acid to the nuclear retinoic acid receptors.
• Reactome Pathway: Signaling by Retinoic Acid (R-HSA-5362517)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Definitive	Biomarker	[1]
Astrocytoma	DISL3V18	Definitive	Altered Expression	[2]
Familial hypercholesterolemia	DISC06IX	Definitive	Genetic Variation	[3]
Hypercholesterolemia, familial, 1	DISU411W	Definitive	Genetic Variation	[3]
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Genetic Variation	[3]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[4]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[5]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[6]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[6]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[7]
Endometriosis	DISX1AG8	Strong	Altered Expression	[8]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[9]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Posttranslational Modification	[10]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[11]
Immunodeficiency	DIS093I0	Strong	Altered Expression	[12]
Invasive ductal breast carcinoma	DIS43J58	Strong	Altered Expression	[13]
Lung cancer	DISCM4YA	Strong	Altered Expression	[4]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[4]
Lung neoplasm	DISVARNB	Strong	Altered Expression	[4]
Malignant peripheral nerve sheath tumor	DIS0JTN6	Strong	Posttranslational Modification	[14]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[15]
Medulloblastoma	DISZD2ZL	Strong	Biomarker	[16]
Melanoma	DIS1RRCY	Strong	Altered Expression	[17]
Neoplasm	DISZKGEW	Strong	Altered Expression	[18]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[19]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[20]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[5]
Pancreatic ductal carcinoma	DIS26F9Q	Strong	Altered Expression	[15]
Prostate cancer	DISF190Y	Strong	Biomarker	[21]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[21]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[7]
Rheumatoid arthritis	DISTSB4J	Strong	Altered Expression	[22]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[23]
Thyroid gland undifferentiated (anaplastic) carcinoma	DISYBB1W	Strong	Altered Expression	[16]
Wilms tumor	DISB6T16	Strong	Biomarker	[18]
Breast cancer	DIS7DPX1	moderate	Biomarker	[6]
Carcinoma	DISH9F1N	moderate	Biomarker	[24]
Lung adenocarcinoma	DISD51WR	moderate	Biomarker	[25]
Neurofibromatosis type 1	DIS53JH9	moderate	Biomarker	[26]
Neural tube defect	DIS5J95E	Disputed	Biomarker	[27]
Atopic dermatitis	DISTCP41	Limited	Biomarker	[28]
Childhood kidney Wilms tumor	DIS0NMK3	Limited	Altered Expression	[19]
Metastatic malignant neoplasm	DIS86UK6	Limited	Genetic Variation	[15]
Methylmalonic acidemia	DISHY8VB	Limited	Biomarker	[29]
Skin disease	DISDW8R6	Limited	Altered Expression	[28]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Docetaxel	DMDI269	Approved	Cellular retinoic acid-binding protein 2 (CRABP2) affects the response to substance of Docetaxel.	[55]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Cellular retinoic acid-binding protein 2 (CRABP2).	[30]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the methylation of Cellular retinoic acid-binding protein 2 (CRABP2).	[31]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Cellular retinoic acid-binding protein 2 (CRABP2).	[47]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[32]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[33]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[34]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[35]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[36]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[37]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[33]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[38]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[36]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[39]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[40]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[41]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate decreases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[42]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide increases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[40]
Alitretinoin	DMME8LH	Approved	Alitretinoin increases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[32]
Dactinomycin	DM2YGNW	Approved	Dactinomycin increases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[40]
Vitamin A	DMJ2AH4	Approved	Vitamin A increases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[43]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[44]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[45]
Coprexa	DMA0WEK	Phase 3	Coprexa decreases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[46]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[48]
PMID27336223-Compound-11	DMBN6KU	Patented	PMID27336223-Compound-11 increases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[49]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[50]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[51]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[52]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[53]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid increases the expression of Cellular retinoic acid-binding protein 2 (CRABP2).	[54]

References

• [1] RNA sequencing identifies novel markers of non-small cell lung cancer.Lung Cancer. 2014 Jun;84(3):229-35. doi: 10.1016/j.lungcan.2014.03.018. Epub 2014 Mar 26.
• [2] CRABP-II- and FABP5-independent responsiveness of human glioblastoma cells to all-trans retinoic acid.Oncotarget. 2015 Mar 20;6(8):5889-902. doi: 10.18632/oncotarget.3334.
• [3] Association of a polymorphism in the promoter of the cellular retinoic acid-binding protein II gene (CRABP2) with increased circulating low-density lipoprotein cholesterol.Clin Chem Lab Med. 2007;45(5):615-20. doi: 10.1515/CCLM.2007.131.
• [4] Crabp2 Promotes Metastasis of Lung Cancer Cells via HuR and Integrin 1/FAK/ERK Signaling.Sci Rep. 2019 Jan 29;9(1):845. doi: 10.1038/s41598-018-37443-4.
• [5] Competitive PCR demonstrates that 9-cis retinoic acid induces cellular retinoic acid-binding protein-II more efficiently than all-trans retinoic acid in human osteosarcoma cells.Biochem Biophys Res Commun. 1994 Apr 29;200(2):1125-9. doi: 10.1006/bbrc.1994.1567.
• [6] CRABP2 regulates invasion and metastasis of breast cancer through hippo pathway dependent on ER status.J Exp Clin Cancer Res. 2019 Aug 16;38(1):361. doi: 10.1186/s13046-019-1345-2.
• [7] Expression and functional influence of cellular retinoic acid-binding protein II in renal cell carcinoma.Urol Int. 2005;75(3):269-76. doi: 10.1159/000087807.
• [8] Effects of simvastatin on retinoic acid system in primary human endometrial stromal cells and in a chimeric model of human endometriosis.J Clin Endocrinol Metab. 2013 Mar;98(3):E463-71. doi: 10.1210/jc.2012-3402. Epub 2013 Jan 21.
• [9] Cellular Retinoic Acid Binding Protein 2 Is Strikingly Downregulated in Human Esophageal Squamous Cell Carcinoma and Functions as a Tumor Suppressor.PLoS One. 2016 Feb 3;11(2):e0148381. doi: 10.1371/journal.pone.0148381. eCollection 2016.
• [10] Epigenetic silencing of CRABP2 and MX1 in head and neck tumors.Neoplasia. 2009 Dec;11(12):1329-39. doi: 10.1593/neo.91110.
• [11] Regulation of Hepatitis C Virus Infection by Cellular Retinoic Acid Binding Proteins through the Modulation of Lipid Droplet Abundance.J Virol. 2019 Apr 3;93(8):e02302-18. doi: 10.1128/JVI.02302-18. Print 2019 Apr 15.
• [12] Mammary carcinoma suppression by cellular retinoic acid binding protein-II.Cancer Res. 2003 Aug 1;63(15):4426-33.
• [13] 4-Amino-2-trifluoromethyl-phenyl retinate inhibits proliferation, invasion, and migration of breast cancer cells by independently regulating CRABP2 and FABP5.Drug Des Devel Ther. 2018 Apr 27;12:997-1008. doi: 10.2147/DDDT.S151029. eCollection 2018.
• [14] MEK inhibitors enhance therapeutic response towards ATRA in NF1 associated malignant peripheral nerve sheath tumors (MPNST) in-vitro.PLoS One. 2017 Nov 13;12(11):e0187700. doi: 10.1371/journal.pone.0187700. eCollection 2017.
• [15] CRABP-II enhances pancreatic cancer cell migration and invasion by stabilizing interleukin 8 expression.Oncotarget. 2016 Dec 26;8(32):52432-52444. doi: 10.18632/oncotarget.14194. eCollection 2017 Aug 8.
• [16] Resveratrol Reverses Retinoic Acid Resistance of Anaplastic Thyroid Cancer Cells via Demethylating CRABP2 Gene.Front Endocrinol (Lausanne). 2019 Oct 29;10:734. doi: 10.3389/fendo.2019.00734. eCollection 2019.
• [17] Vitamin A metabolism and mRNA expression of retinoid-binding protein and receptor genes in human epidermal melanocytes and melanoma cells.Melanoma Res. 1997 Aug;7(4):267-74. doi: 10.1097/00008390-199708000-00001.
• [18] Tissue expression of retinoic acid receptor alpha and CRABP2 in metastatic nephroblastomas.Diagn Pathol. 2018 Jan 22;13(1):9. doi: 10.1186/s13000-018-0686-z.
• [19] Regulation of CRABP-II expression by MycN in Wilms tumor.Exp Cell Res. 2008 Dec 10;314(20):3663-8. doi: 10.1016/j.yexcr.2008.09.029. Epub 2008 Oct 14.
• [20] Plasma CRABP2 as a Novel Biomarker in Patients with Non-Small Cell Lung Cancer.J Korean Med Sci. 2018 May 16;33(26):e178. doi: 10.3346/jkms.2018.33.e178. eCollection 2018 Jun 25.
• [21] Cellular retinoic acid-binding protein 2 is down-regulated in prostate cancer.Int J Oncol. 2005 Nov;27(5):1273-82.
• [22] Uncovering Cellular retinoic acid-binding protein 2 as a potential target for rheumatoid arthritis synovial hyperplasia.Sci Rep. 2018 Jun 7;8(1):8731. doi: 10.1038/s41598-018-26027-x.
• [23] Loss of CRABP-II Characterizes Human Skin Poorly Differentiated Squamous Cell Carcinomas and Favors DMBA/TPA-Induced Carcinogenesis.J Invest Dermatol. 2016 Jun;136(6):1255-1266. doi: 10.1016/j.jid.2016.01.039. Epub 2016 Mar 2.
• [24] Cellular retinoic acid-binding protein 2 inhibits tumor growth by two distinct mechanisms.J Biol Chem. 2014 Dec 5;289(49):34065-73. doi: 10.1074/jbc.M114.604041. Epub 2014 Oct 15.
• [25] Integrated analysis reveals candidate genes and transcription factors in lung adenocarcinoma.Mol Med Rep. 2017 Dec;16(6):8371-8379. doi: 10.3892/mmr.2017.7656. Epub 2017 Sep 28.
• [26] The Cellular Retinoic Acid Binding Protein 2 Promotes Survival of Malignant Peripheral Nerve Sheath Tumor Cells.Am J Pathol. 2017 Jul;187(7):1623-1632. doi: 10.1016/j.ajpath.2017.02.021. Epub 2017 May 11.
• [27] Analysis of ALDH1A2, CYP26A1, CYP26B1, CRABP1, and CRABP2 in human neural tube defects suggests a possible association with alleles in ALDH1A2.Birth Defects Res A Clin Mol Teratol. 2005 Nov;73(11):868-75. doi: 10.1002/bdra.20183.
• [28] Differential expression of CRABP II, psoriasin and cytokeratin 1 mRNA in human skin diseases.Arch Dermatol Res. 1996 Jul;288(8):426-30. doi: 10.1007/BF02505229.
• [29] Quantitative analysis of mitochondrial protein expression in methylmalonic acidemia by two-dimensional difference gel electrophoresis.J Proteome Res. 2006 Jul;5(7):1602-10. doi: 10.1021/pr050481r.
• [30] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [31] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [32] Biological effects and metabolism of 9-cis-retinoic acid and its metabolite 9,13-di-cis-retinoic acid in HaCaT keratinocytes in vitro: comparison with all-trans-retinoic acid. Arch Dermatol Res. 2000 Dec;292(12):612-20. doi: 10.1007/s004030000189.
• [33] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [34] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [35] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [36] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [37] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [38] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [39] Molecular targeting of retinoic acid metabolism in neuroblastoma: the role of the CYP26 inhibitor R116010 in vitro and in vivo. Br J Cancer. 2007 Jun 4;96(11):1675-83.
• [40] Genomic profiling uncovers a molecular pattern for toxicological characterization of mutagens and promutagens in vitro. Toxicol Sci. 2011 Jul;122(1):185-97.
• [41] Nicotinic modulation of gene expression in SH-SY5Y neuroblastoma cells. Brain Res. 2006 Oct 20;1116(1):39-49.
• [42] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [43] Molecular and metabolic retinoid pathways in human amniotic membranes. Biochem Biophys Res Commun. 2006 Aug 11;346(4):1207-16. doi: 10.1016/j.bbrc.2006.06.024. Epub 2006 Jun 12.
• [44] Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.
• [45] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [46] Copper chelator ATN-224 inhibits endothelial function by multiple mechanisms. Microvasc Res. 2009 May;77(3):314-26.
• [47] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [48] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [49] Comparison of CD271 (adapalene) and all-trans retinoic acid in human skin: dissociation of epidermal effects and CRABP-II mRNA expression. J Invest Dermatol. 1993 Sep;101(3):325-8. doi: 10.1111/1523-1747.ep12365480.
• [50] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [51] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [52] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [53] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [54] Beta-carotene and apocarotenals promote retinoid signaling in BEAS-2B human bronchioepithelial cells. Arch Biochem Biophys. 2006 Nov 1;455(1):48-60.
• [55] The prognostic gene CRABP2 affects drug sensitivity by regulating docetaxel-induced apoptosis in breast invasive carcinoma: A pan-cancer analysis. Chem Biol Interact. 2023 Mar 1;373:110372. doi: 10.1016/j.cbi.2023.110372. Epub 2023 Feb 2.