Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0HENJ5)

• DOT Name: Nuclear factor erythroid 2-related factor 2 (NFE2L2)
• Synonyms: NF-E2-related factor 2; NFE2-related factor 2; Nrf-2; HEBP1; Nuclear factor, erythroid derived 2, like 2
• Gene Name: NFE2L2
• Related Disease: Immunodeficiency, developmental delay, and hypohomocysteinemia
• UniProt ID: NF2L2_HUMAN
• PDB ID: 2FLU; 2LZ1; 3ZGC; 4IFL; 5WFV; 6T7V; 7K28; 7K29; 7K2A; 7K2B; 7K2C; 7K2D; 7K2E; 7K2K; 7O7B; 7X5E; 7X5F; 7X5G; 8EJR; 8EJS
• Pfam ID: PF03131
• Sequence:
  MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQE
  QLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCM
  QLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGM
  QQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVG
  NCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMP
  SPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHS
  VESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDA
  QCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVD
  FNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLL
  KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKP
  DVKKN
• Function: Transcription factor that plays a key role in the response to oxidative stress: binds to antioxidant response (ARE) elements present in the promoter region of many cytoprotective genes, such as phase 2 detoxifying enzymes, and promotes their expression, thereby neutralizing reactive electrophiles. In normal conditions, ubiquitinated and degraded in the cytoplasm by the BCR(KEAP1) complex. In response to oxidative stress, electrophile metabolites inhibit activity of the BCR(KEAP1) complex, promoting nuclear accumulation of NFE2L2/NRF2, heterodimerization with one of the small Maf proteins and binding to ARE elements of cytoprotective target genes. The NFE2L2/NRF2 pathway is also activated in response to selective autophagy: autophagy promotes interaction between KEAP1 and SQSTM1/p62 and subsequent inactivation of the BCR(KEAP1) complex, leading to NFE2L2/NRF2 nuclear accumulation and expression of cytoprotective genes. May also be involved in the transcriptional activation of genes of the beta-globin cluster by mediating enhancer activity of hypersensitive site 2 of the beta-globin locus control region. Also plays an important role in the regulation of the innate immune response and antiviral cytosolic DNA sensing. It is a critical regulator of the innate immune response and survival during sepsis by maintaining redox homeostasis and restraint of the dysregulation of pro-inflammatory signaling pathways like MyD88-dependent and -independent and TNF-alpha signaling. Suppresses macrophage inflammatory response by blocking pro-inflammatory cytokine transcription and the induction of IL6. Binds to the proximity of pro-inflammatory genes in macrophages and inhibits RNA Pol II recruitment. The inhibition is independent of the NRF2-binding motif and reactive oxygen species level. Represses antiviral cytosolic DNA sensing by suppressing the expression of the adapter protein STING1 and decreasing responsiveness to STING1 agonists while increasing susceptibility to infection with DNA viruses. Once activated, limits the release of pro-inflammatory cytokines in response to human coronavirus SARS-CoV-2 infection and to virus-derived ligands through a mechanism that involves inhibition of IRF3 dimerization. Also inhibits both SARS-CoV-2 replication, as well as the replication of several other pathogenic viruses including Herpes Simplex Virus-1 and-2, Vaccinia virus, and Zika virus through a type I interferon (IFN)-independent mechanism.
• Tissue Specificity: Widely expressed. Highest expression in adult muscle, kidney, lung, liver and in fetal muscle.
• KEGG Pathway:
  Protein processing in endoplasmic reticulum (hsa04141)
  Parkinson disease (hsa05012)
  Pathways in cancer (hsa05200)
  Chemical carcinogenesis - reactive oxygen species (hsa05208)
  Hepatocellular carcinoma (hsa05225)
  Lipid and atherosclerosis (hsa05417)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway:
  Potential therapeutics for SARS (R-HSA-9679191)
  Regulation of HMOX1 expression and activity (R-HSA-9707587)
  Heme signaling (R-HSA-9707616)
  KEAP1-NFE2L2 pathway (R-HSA-9755511)
  Nuclear events mediated by NFE2L2 (R-HSA-9759194)
  GSK3B and BTRC (R-HSA-9762114)
  NFE2L2 regulating TCA cycle genes (R-HSA-9818025)
  NFE2L2 regulating inflammation associated genes (R-HSA-9818026)
  NFE2L2 regulating anti-oxidant/detoxification enzymes (R-HSA-9818027)
  NFE2L2 regulates pentose phosphate pathway genes (R-HSA-9818028)
  NFE2L2 regulating tumorigenic genes (R-HSA-9818030)
  NFE2L2 regulating MDR associated enzymes (R-HSA-9818032)
  NFE2L2 regulating ER-stress associated genes (R-HSA-9818035)
  Regulation of NFE2L2 gene expression (R-HSA-9818749)
  Neddylation (R-HSA-8951664)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Immunodeficiency, developmental delay, and hypohomocysteinemia	DIS41C6F	Strong	Autosomal dominant	[1]

This DOT Affected the Drug Response of 15 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Nuclear factor erythroid 2-related factor 2 (NFE2L2) decreases the response to substance of Fluorouracil.	[81]
Troglitazone	DM3VFPD	Approved	Nuclear factor erythroid 2-related factor 2 (NFE2L2) affects the response to substance of Troglitazone.	[82]
Etoposide	DMNH3PG	Approved	Nuclear factor erythroid 2-related factor 2 (NFE2L2) decreases the response to substance of Etoposide.	[83]
Paclitaxel	DMLB81S	Approved	Nuclear factor erythroid 2-related factor 2 (NFE2L2) decreases the response to substance of Paclitaxel.	[84]
Clozapine	DMFC71L	Approved	Nuclear factor erythroid 2-related factor 2 (NFE2L2) affects the response to substance of Clozapine.	[82]
Chenodiol	DMQ8JIK	Approved	Nuclear factor erythroid 2-related factor 2 (NFE2L2) decreases the response to substance of Chenodiol.	[85]
Chlorambucil	DMRKE63	Approved	Nuclear factor erythroid 2-related factor 2 (NFE2L2) increases the response to substance of Chlorambucil.	[86]
Flutamide	DMK0O7U	Approved	Nuclear factor erythroid 2-related factor 2 (NFE2L2) affects the response to substance of Flutamide.	[82]
Terbinafine	DMI6HUW	Approved	Nuclear factor erythroid 2-related factor 2 (NFE2L2) affects the response to substance of Terbinafine.	[82]
Desipramine	DMT2FDC	Approved	Nuclear factor erythroid 2-related factor 2 (NFE2L2) affects the response to substance of Desipramine.	[82]
crotylaldehyde	DMTWRQI	Investigative	Nuclear factor erythroid 2-related factor 2 (NFE2L2) decreases the response to substance of crotylaldehyde.	[87]
acrolein	DMAMCSR	Investigative	Nuclear factor erythroid 2-related factor 2 (NFE2L2) increases the response to substance of acrolein.	[86]
	DM9CEI5		Nuclear factor erythroid 2-related factor 2 (NFE2L2) decreases the response to substance of .	[85]
Chlorogenic acid	DM2Y3P4	Investigative	Nuclear factor erythroid 2-related factor 2 (NFE2L2) increases the response to substance of Chlorogenic acid.	[89]
Plumbagin	DM9BS50	Investigative	Nuclear factor erythroid 2-related factor 2 (NFE2L2) affects the response to substance of Plumbagin.	[90]

This DOT Affected the Regulation of Drug Effects of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Glutathione	DMAHMT9	Approved	Nuclear factor erythroid 2-related factor 2 (NFE2L2) decreases the abundance of Glutathione.	[86]
Nitrobenzanthrone	DMN6L70	Investigative	Nuclear factor erythroid 2-related factor 2 (NFE2L2) affects the metabolism of Nitrobenzanthrone.	[88]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[2]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[77]

87 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[7]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[8]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[9]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[10]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[11]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[12]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[13]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[14]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[15]
Carbamazepine	DMZOLBI	Approved	Carbamazepine increases the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[16]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[17]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[18]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[19]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[20]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[21]
Bortezomib	DMNO38U	Approved	Bortezomib increases the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[15]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[22]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[23]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[24]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[25]
Cidofovir	DMA13GD	Approved	Cidofovir affects the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[27]
Simvastatin	DM30SGU	Approved	Simvastatin increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[28]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[29]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[30]
Fenofibrate	DMFKXDY	Approved	Fenofibrate affects the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[27]
Rifampicin	DM5DSFZ	Approved	Rifampicin increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[31]
Ifosfamide	DMCT3I8	Approved	Ifosfamide affects the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[27]
Clodronate	DM9Y6X7	Approved	Clodronate affects the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[27]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[27]
Clorgyline	DMCEUJD	Approved	Clorgyline increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[33]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[34]
Vitamin C	DMXJ7O8	Approved	Vitamin C increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[35]
Imatinib	DM7RJXL	Approved	Imatinib decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[37]
Sertraline	DM0FB1J	Approved	Sertraline increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[38]
Ritonavir	DMU764S	Approved	Ritonavir increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[39]
Cholecalciferol	DMGU74E	Approved	Cholecalciferol increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[41]
Ardeparin	DMYRX8B	Approved	Ardeparin increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[42]
Melatonin	DMKWFBT	Approved	Melatonin increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[43]
Eicosapentaenoic acid/docosa-hexaenoic acid	DMMUCG4	Approved	Eicosapentaenoic acid/docosa-hexaenoic acid increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[44]
Dihydroxyacetone	DMM1LG2	Approved	Dihydroxyacetone increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[45]
Hesperetin	DMKER83	Approved	Hesperetin increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[46]
Lapatinib	DM3BH1Y	Approved	Lapatinib increases the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[48]
Busulfan	DMXYJ9C	Approved	Busulfan increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[49]
Ethacrynic acid	DM60QMR	Approved	Ethacrynic acid increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[50]
Gallium nitrate	DMF9O6B	Approved	Gallium nitrate increases the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[51]
Tolcapone	DM8MNVO	Approved	Tolcapone decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[52]
Cilostazol	DMZMSCT	Approved	Cilostazol increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[53]
Furazolidone	DM3P6V7	Approved	Furazolidone increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[54]
Roflumilast	DMPGHY8	Approved	Roflumilast increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[55]
Trabectedin	DMG3Y89	Approved	Trabectedin decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[57]
Carfilzomib	DM48K0X	Approved	Carfilzomib increases the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[15]
Trifluridine	DMG2YBD	Approved	Trifluridine increases the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[15]
Proflavine	DMF1X5P	Approved	Proflavine increases the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[15]
Berberine	DMC5Q8X	Phase 4	Berberine increases the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[15]
Silymarin	DMXBYQR	Phase 4	Silymarin increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[60]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[61]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[4]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[62]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[63]
Fenretinide	DMRD5SP	Phase 3	Fenretinide increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[64]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin increases the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[65]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[14]
Atorvastatin	DMF28YC	Phase 3 Trial	Atorvastatin decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[66]
Bardoxolone methyl	DMODA2X	Phase 3	Bardoxolone methyl increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[64]
I3C	DMIGFOR	Phase 3	I3C decreases the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[67]
Triptolide	DMCMDVR	Phase 3	Triptolide decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[68]
Psoralen	DMIZJ8M	Phase 3	Psoralen decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[37]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[69]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[70]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[18]
DNCB	DMDTVYC	Phase 2	DNCB decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[22]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[71]
PEITC	DMOMN31	Phase 2	PEITC increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[72]
Metoprine	DM5GQD7	Phase 2	Metoprine increases the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[15]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[73]
ME-344	DM6JN19	Phase 1/2	ME-344 increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[74]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[3]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[75]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[76]
LY294002	DMY1AFS	Phase 1	LY294002 decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[78]
Eugenol	DM7US1H	Patented	Eugenol decreases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[22]
PMID26560530-Compound-34	DMLGZPO	Patented	PMID26560530-Compound-34 increases the activity of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[79]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[80]

11 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Diclofenac	DMPIHLS	Approved	Diclofenac increases the stability of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[16]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the localization of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[26]
Capsaicin	DMGMF6V	Approved	Capsaicin increases the localization of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[32]
Ursodeoxycholic acid	DMCUT21	Approved	Ursodeoxycholic acid increases the localization of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[36]
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin affects the localization of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[40]
Artesunate	DMR27C8	Approved	Artesunate affects the localization of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[40]
Nifedipine	DMSVOZT	Approved	Nifedipine affects the localization of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[47]
Bromocriptine	DMVE3TK	Approved	Bromocriptine increases the localization of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[56]
Tecfidera	DM2OVDT	Approved	Tecfidera affects the localization of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[58]
Duloxetine	DM9BI7M	Approved	Duloxetine affects the localization of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[59]
Verapamil	DMA7PEW	Phase 2/3 Trial	Verapamil affects the localization of Nuclear factor erythroid 2-related factor 2 (NFE2L2).	[47]

References

• [1] Prevalence and architecture of de novo mutations in developmental disorders. Nature. 2017 Feb 23;542(7642):433-438. doi: 10.1038/nature21062. Epub 2017 Jan 25.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [5] A cellular model to study drug-induced liver injury in nonalcoholic fatty liver disease: application to acetaminophen. Toxicol Appl Pharmacol. 2016 Feb 1;292:40-55.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [8] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [9] MicroRNA-93 regulates NRF2 expression and is associated with breast carcinogenesis. Carcinogenesis. 2013 May;34(5):1165-72. doi: 10.1093/carcin/bgt026. Epub 2013 Mar 14.
• [10] SAM and folic acid prevent arsenic-induced oxidative and nitrative DNA damage in human lymphoblast cells by modulating expression of inflammatory and DNA repair genes. Chem Biol Interact. 2022 Jul 1;361:109965. doi: 10.1016/j.cbi.2022.109965. Epub 2022 Apr 28.
• [11] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [12] Arsenic trioxide inhibits the differentiation of fibroblasts to myofibroblasts through nuclear factor erythroid 2-like 2 (NFE2L2) protein and the Smad2/3 pathway. J Cell Physiol. 2019 Mar;234(3):2606-2617. doi: 10.1002/jcp.27073. Epub 2018 Oct 14.
• [13] Gypenosides protect retinal pigment epithelium cells from oxidative stress. Food Chem Toxicol. 2018 Feb;112:76-85.
• [14] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [15] Identification of Compounds That Inhibit Estrogen-Related Receptor Alpha Signaling Using High-Throughput Screening Assays. Molecules. 2019 Feb 27;24(5):841. doi: 10.3390/molecules24050841.
• [16] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [17] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [18] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [19] Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
• [20] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [21] Gingival Stromal Cells as an In Vitro Model: Cannabidiol Modulates Genes Linked With Amyotrophic Lateral Sclerosis. J Cell Biochem. 2017 Apr;118(4):819-828. doi: 10.1002/jcb.25757. Epub 2016 Nov 28.
• [22] Effects of hair dye ingredients on the oxidative stress response: Modulation of the mRNA expressions of NRF2, HO-1, and FOS in HaCaT keratinocytes. Contact Dermatitis. 2020 May;82(5):332-334. doi: 10.1111/cod.13478. Epub 2020 Feb 6.
• [23] PPARgama activation rescues mitochondrial function from inhibition of complex I and loss of PINK1. Exp Neurol. 2014 Mar;253:16-27.
• [24] Gallic acid protects against ethanol-induced hepatocyte necroptosis via an NRF2-dependent mechanism. Toxicol In Vitro. 2019 Jun;57:226-232. doi: 10.1016/j.tiv.2019.03.008. Epub 2019 Mar 7.
• [25] The PPAR-dependent effect of flavonoid luteolin against damage induced by the chemotherapeutic irinotecan in human intestinal cells. Chem Biol Interact. 2022 Jan 5;351:109712. doi: 10.1016/j.cbi.2021.109712. Epub 2021 Oct 23.
• [26] Redox-sensitive interaction between KIAA0132 and Nrf2 mediates indomethacin-induced expression of gamma-glutamylcysteine synthetase. Free Radic Biol Med. 2002 Apr 1;32(7):650-62. doi: 10.1016/s0891-5849(02)00755-4.
• [27] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [28] Simvastatin protects dopaminergic neurons against MPP+-induced oxidative stress and regulates the endogenous anti-oxidant system through ERK. Cell Physiol Biochem. 2018;51(4):1957-1968.
• [29] CASC9 potentiates gemcitabine resistance in pancreatic cancer by reciprocally activating NRF2 and the NF-B signaling pathway. Cell Biol Toxicol. 2023 Aug;39(4):1549-1560. doi: 10.1007/s10565-022-09746-w. Epub 2022 Aug 1.
• [30] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [31] Rifampicin activates AMPK and alleviates oxidative stress in the liver as mediated with Nrf2 signaling. Chem Biol Interact. 2020 Jan 5;315:108889. doi: 10.1016/j.cbi.2019.108889. Epub 2019 Nov 1.
• [32] Capsaicin induces heme oxygenase-1 expression in HepG2 cells via activation of PI3K-Nrf2 signaling: NAD(P)H:quinone oxidoreductase as a potential target. Antioxid Redox Signal. 2007 Dec;9(12):2087-98.
• [33] Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
• [34] Establishment of a 13 genes-based molecular prediction score model to discriminate the neurotoxic potential of food relevant-chemicals. Toxicol Lett. 2022 Feb 1;355:1-18. doi: 10.1016/j.toxlet.2021.10.013. Epub 2021 Nov 5.
• [35] Identification of lead-produced lipid hydroperoxides in human HepG2 cells and protection using rosmarinic and ascorbic acids with a reference to their regulatory roles on Nrf2-Keap1 antioxidant pathway. Chem Biol Interact. 2019 Dec 1;314:108847. doi: 10.1016/j.cbi.2019.108847. Epub 2019 Oct 11.
• [36] Ursodeoxycholic acid induces glutathione synthesis through activation of PI3K/Akt pathway in HepG2 cells. Biochem Pharmacol. 2009 Mar 1;77(5):858-66. doi: 10.1016/j.bcp.2008.11.012. Epub 2008 Nov 25.
• [37] A new strategy for the rapid identification and validation of direct toxicity targets of psoralen-induced hepatotoxicity. Toxicol Lett. 2022 Jun 15;363:11-26. doi: 10.1016/j.toxlet.2022.05.002. Epub 2022 May 18.
• [38] Sertraline induces endoplasmic reticulum stress in hepatic cells. Toxicology. 2014 Aug 1;322:78-88. doi: 10.1016/j.tox.2014.05.007. Epub 2014 May 24.
• [39] Heme oxygenase-1-derived bilirubin counteracts HIV protease inhibitor-mediated endothelial cell dysfunction. Free Radic Biol Med. 2016 May;94:218-29. doi: 10.1016/j.freeradbiomed.2016.03.003. Epub 2016 Mar 8.
• [40] Untargeted Proteomics and Systems-Based Mechanistic Investigation of Artesunate in Human Bronchial Epithelial Cells. Chem Res Toxicol. 2015 Oct 19;28(10):1903-13. doi: 10.1021/acs.chemrestox.5b00105. Epub 2015 Sep 21.
• [41] Vitamin D protects against particles-caused lung injury through induction of autophagy in an Nrf2-dependent manner. Environ Toxicol. 2019 May;34(5):594-609.
• [42] Biochemical and toxicological evaluation of nano-heparins in cell functional properties, proteasome activation and expression of key matrix molecules. Toxicol Lett. 2016 Jan 5;240(1):32-42. doi: 10.1016/j.toxlet.2015.10.005. Epub 2015 Oct 22.
• [43] Melatonin prevents blood-retinal barrier breakdown and mitochondrial dysfunction in high glucose and hypoxia-induced in vitro diabetic macular edema model. Toxicol In Vitro. 2021 Sep;75:105191. doi: 10.1016/j.tiv.2021.105191. Epub 2021 May 5.
• [44] Astaxanthin and omega-3 fatty acids individually and in combination protect against oxidative stress via the Nrf2-ARE pathway. Food Chem Toxicol. 2013 Dec;62:869-75.
• [45] The sunless tanning agent dihydroxyacetone induces stress response gene expression and signaling in cultured human keratinocytes and reconstructed epidermis. Redox Biol. 2020 Sep;36:101594. doi: 10.1016/j.redox.2020.101594. Epub 2020 May 29.
• [46] Hesperetin relieves cisplatin-induced acute kidney injury by mitigating oxidative stress, inflammation and apoptosis. Chem Biol Interact. 2019 Aug 1;308:269-278.
• [47] Protective role of HO-1 for alcohol-dependent liver damage. Dig Dis. 2010;28(6):792-8. doi: 10.1159/000324287. Epub 2011 Apr 27.
• [48] P450 3A-catalyzed O-dealkylation of lapatinib induces mitochondrial stress and activates Nrf2. Chem Res Toxicol. 2016 May 16;29(5):784-96.
• [49] Direct transcriptomic comparison of xenobiotic metabolism and toxicity pathway induction of airway epithelium models at an air-liquid interface generated from induced pluripotent stem cells and primary bronchial epithelial cells. Cell Biol Toxicol. 2023 Feb;39(1):1-18. doi: 10.1007/s10565-022-09726-0. Epub 2022 May 31.
• [50] Cellular iron depletion weakens induction of heme oxygenase-1 by cadmium. Int J Biochem Cell Biol. 2011 Jan;43(1):88-97.
• [51] Role of oxidative stress in the induction of metallothionein-2A and heme oxygenase-1 gene expression by the antineoplastic agent gallium nitrate in human lymphoma cells. Free Radic Biol Med. 2008 Sep 15;45(6):763-72.
• [52] The catechol-O-methyltransferase inhibitors tolcapone and entacapone uncouple and inhibit the mitochondrial respiratory chain in HepaRG cells. Toxicol In Vitro. 2017 Aug;42:337-347.
• [53] Cilostazol enhances apoptosis of synovial cells from rheumatoid arthritis patients with inhibition of cytokine formation via Nrf2-linked heme oxygenase 1 induction. Arthritis Rheum. 2010 Mar;62(3):732-41. doi: 10.1002/art.27291.
• [54] P21(Waf1/Cip1) plays a critical role in furazolidone-induced apoptosis in HepG2 cells through influencing the caspase-3 activation and ROS generation. Food Chem Toxicol. 2016 Feb;88:1-12. doi: 10.1016/j.fct.2015.12.004. Epub 2015 Dec 11.
• [55] Roflumilast protects from cisplatin-induced testicular toxicity in male rats and enhances its cytotoxicity in prostate cancer cell line. Role of NF-B-p65, cAMP/PKA and Nrf2/HO-1, NQO1 signaling. Food Chem Toxicol. 2021 May;151:112133. doi: 10.1016/j.fct.2021.112133. Epub 2021 Mar 20.
• [56] Bromocriptine methylate suppresses glial inflammation and moderates disease progression in a mouse model of amyotrophic lateral sclerosis. Exp Neurol. 2011 Nov;232(1):41-52. doi: 10.1016/j.expneurol.2011.08.001. Epub 2011 Aug 16.
• [57] Trabectedin induces ferroptosis via regulation of HIF-1/IRP1/TFR1 and Keap1/Nrf2/GPX4 axis in non-small cell lung cancer cells. Chem Biol Interact. 2023 Jan 5;369:110262. doi: 10.1016/j.cbi.2022.110262. Epub 2022 Nov 14.
• [58] Distinct Nrf2 Signaling Mechanisms of Fumaric Acid Esters and Their Role in Neuroprotection against 1-Methyl-4-Phenyl-1,2,3,6-Tetrahydropyridine-Induced Experimental Parkinson's-Like Disease. J Neurosci. 2016 Jun 8;36(23):6332-51. doi: 10.1523/JNEUROSCI.0426-16.2016.
• [59] Duloxetine Protects Human Neuroblastoma Cells from Oxidative Stress-Induced Cell Death Through Akt/Nrf-2/HO-1 Pathway. Neurochem Res. 2018 Feb;43(2):387-396. doi: 10.1007/s11064-017-2433-3. Epub 2017 Nov 13.
• [60] Antioxidant effect of silymarin on paraquat-induced human lung adenocarcinoma A549 cell line. Food Chem Toxicol. 2012 Sep;50(9):3206-14. doi: 10.1016/j.fct.2012.06.007. Epub 2012 Jun 16.
• [61] Resveratrol induces apoptosis and alters gene expression in human fibrosarcoma cells. Anticancer Res. 2015 Feb;35(2):767-74.
• [62] Epigallocatechin-3-gallate partially restored redox homeostasis in arsenite-stressed keratinocytes. J Appl Toxicol. 2018 Aug;38(8):1071-1080. doi: 10.1002/jat.3616. Epub 2018 Mar 23.
• [63] Neuroprotective effects of glucomoringin-isothiocyanate against H(2)O(2)-Induced cytotoxicity in neuroblastoma (SH-SY5Y) cells. Neurotoxicology. 2019 Dec;75:89-104. doi: 10.1016/j.neuro.2019.09.008. Epub 2019 Sep 12.
• [64] Glycogen synthase kinase 3 regulates cell death and survival signaling in tumor cells under redox stress. Neoplasia. 2014 Sep;16(9):710-22.
• [65] Camptothecin induces c-Myc- and Sp1-mediated hTERT expression in LNCaP cells: Involvement of reactive oxygen species and PI3K/Akt. Food Chem Toxicol. 2019 May;127:53-60. doi: 10.1016/j.fct.2019.03.001. Epub 2019 Mar 6.
• [66] Atorvastatin induces mitochondrial dysfunction and cell apoptosis in HepG2 cells via inhibition of the Nrf2 pathway. J Appl Toxicol. 2019 Oct;39(10):1394-1404. doi: 10.1002/jat.3825. Epub 2019 Aug 18.
• [67] Molecular targets and anticancer potential of indole-3-carbinol and its derivatives. Cell Cycle. 2005 Sep;4(9):1201-15. doi: 10.4161/cc.4.9.1993. Epub 2005 Sep 6.
• [68] Catalpol and panax notoginseng saponins synergistically alleviate triptolide-induced hepatotoxicity through Nrf2/ARE pathway. Toxicol In Vitro. 2019 Apr;56:141-149. doi: 10.1016/j.tiv.2019.01.016. Epub 2019 Jan 23.
• [69] Ashwagandha leaf derived withanone protects normal human cells against the toxicity of methoxyacetic acid, a major industrial metabolite. PLoS One. 2011 May 4;6(5):e19552. doi: 10.1371/journal.pone.0019552.
• [70] Capturing time-dependent activation of genes and stress-response pathways using transcriptomics in iPSC-derived renal proximal tubule cells. Cell Biol Toxicol. 2023 Aug;39(4):1773-1793. doi: 10.1007/s10565-022-09783-5. Epub 2022 Dec 31.
• [71] Nrf2 expression and activity in human T lymphocytes: stimulation by T cell receptor activation and priming by inorganic arsenic and tert-butylhydroquinone. Free Radic Biol Med. 2014 Jun;71:133-145. doi: 10.1016/j.freeradbiomed.2014.03.006. Epub 2014 Mar 13.
• [72] Combination of xanthohumol and phenethyl isothiocyanate inhibits NF-B and activates Nrf2 in pancreatic cancer cells. Toxicol In Vitro. 2020 Jun;65:104799. doi: 10.1016/j.tiv.2020.104799. Epub 2020 Feb 15.
• [73] OTX015 Epi-Drug Exerts Antitumor Effects in Ovarian Cancer Cells by Blocking GNL3-Mediated Radioresistance Mechanisms: Cellular, Molecular and Computational Evidence. Cancers (Basel). 2021 Mar 25;13(7):1519. doi: 10.3390/cancers13071519.
• [74] Isoflavone ME-344 Disrupts Redox Homeostasis and Mitochondrial Function by Targeting Heme Oxygenase 1. Cancer Res. 2019 Aug 15;79(16):4072-4085. doi: 10.1158/0008-5472.CAN-18-3503. Epub 2019 Jun 21.
• [75] Bromodomain and extraterminal proteins suppress NF-E2-related factor 2-mediated antioxidant gene expression. J Immunol. 2014 May 15;192(10):4913-4920.
• [76] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [77] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [78] Chrysin enhances sensitivity of BEL-7402/ADM cells to doxorubicin by suppressing PI3K/Akt/Nrf2 and ERK/Nrf2 pathway. Chem Biol Interact. 2013 Oct 25;206(1):100-8.
• [79] Characterization of arsenic hepatobiliary transport using sandwich-cultured human hepatocytes. Toxicol Sci. 2015 Jun;145(2):307-20. doi: 10.1093/toxsci/kfv051. Epub 2015 Mar 9.
• [80] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [81] Nrf2 is overexpressed in pancreatic cancer: implications for cell proliferation and therapy. Mol Cancer. 2011 Apr 13;10:37. doi: 10.1186/1476-4598-10-37.
• [82] Development of a highly sensitive cytotoxicity assay system for CYP3A4-mediated metabolic activation. Drug Metab Dispos. 2011 Aug;39(8):1388-95. doi: 10.1124/dmd.110.037077. Epub 2011 May 3.
• [83] Suppression of NRF2-ARE activity sensitizes chemotherapeutic agent-induced cytotoxicity in human acute monocytic leukemia cells. Toxicol Appl Pharmacol. 2016 Feb 1;292:1-7. doi: 10.1016/j.taap.2015.12.008. Epub 2015 Dec 18.
• [84] High levels of Nrf2 determine chemoresistance in type II endometrial cancer. Cancer Res. 2010 Jul 1;70(13):5486-96. doi: 10.1158/0008-5472.CAN-10-0713. Epub 2010 Jun 8.
• [85] Activation of nuclear factor (erythroid-2 like) factor 2 by toxic bile acids provokes adaptive defense responses to enhance cell survival at the emergence of oxidative stress. Mol Pharmacol. 2007 Nov;72(5):1380-90. doi: 10.1124/mol.107.039370. Epub 2007 Aug 27.
• [86] Characterization of the cancer chemopreventive NRF2-dependent gene battery in human keratinocytes: demonstration that the KEAP1-NRF2 pathway, and not the BACH1-NRF2 pathway, controls cytoprotection against electrophiles as well as redox-cycling compounds. Carcinogenesis. 2009 Sep;30(9):1571-80. doi: 10.1093/carcin/bgp176. Epub 2009 Jul 16.
• [87] Upregulation of heme oxygenase-1 as an adaptive mechanism for protection against crotonaldehyde in human umbilical vein endothelial cells. Toxicol Lett. 2011 Mar 25;201(3):240-8. doi: 10.1016/j.toxlet.2011.01.006. Epub 2011 Jan 14.
• [88] Induction of the Antioxidant Response by the Transcription Factor NRF2 Increases Bioactivation of the Mutagenic Air Pollutant 3-Nitrobenzanthrone in Human Lung Cells. Chem Res Toxicol. 2019 Dec 16;32(12):2538-2551. doi: 10.1021/acs.chemrestox.9b00399. Epub 2019 Nov 20.
• [89] Natural polyphenol chlorogenic acid protects against acetaminophen-induced hepatotoxicity by activating ERK/Nrf2 antioxidative pathway. Toxicol Sci. 2018 Mar 1;162(1):99-112.
• [90] Plumbagin, a novel Nrf2/ARE activator, protects against cerebral ischemia. J Neurochem. 2010 Mar;112(5):1316-26.