Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3A3RD7)

• DOT Name: BTB/POZ domain-containing protein 8 (BTBD8)
• Synonyms: AP2-interacting clathrin-endocytosis; APache
• Gene Name: BTBD8
• Related Disease:
  Nervous system disease
  Subarachnoid hemorrhage
  Acute leukaemia
  Acute liver failure
  Advanced cancer
  Aortic aneurysm
  Brain neoplasm
  Cardiac arrest
  Cardiac disease
  Cardiac failure
  Cardiovascular disease
  Central diabetes insipidus
  Cerebral infarction
  Chronic obstructive pulmonary disease
  Coagulation defect
  Congestive heart failure
  Coronary atherosclerosis
  Coronary heart disease
  Depression
  Disseminated intravascular coagulation
  High blood pressure
  HIV infectious disease
  Interstitial cystitis
  Kidney failure
  Leukopenia
  Liver cirrhosis
  Liver failure
  Mental disorder
  Neoplasm
  Non-alcoholic fatty liver disease
  Pancreatitis
  Respiratory disease
  Status epilepticus seizure
  Substance abuse
  Thrombocytopenia
  Type-1/2 diabetes
  Acute myelogenous leukaemia
  Adult respiratory distress syndrome
  Alcohol dependence
  Delirium
  Early-onset anterior polar cataract
  Inflammatory bowel disease
  Myocardial ischemia
  Acute respiratory failure
  Influenza
  Methicillin-resistant staphylococci infection
  Myocardial infarction
  Pneumocystis pneumonia
• UniProt ID: BTBD8_HUMAN
• Pfam ID: PF00651 ; PF15363
• Sequence:
  MARCGEGSAAPMVLLGSAGVCSKGLQRKGPCERRRLKATVSEQLSQDLLRLLREEFHTDV
  TFSVGCTLFKAHKAVLLARVPDFYFHTIGQTSNSLTNQEPIAVENVEALEFRTFLQIIYS
  SNRNIKNYEEEILRKKIMEIGISQKQLDISFPKCENSSDCSLQKHEIPEDISDRDDDFIS
  NDNYDLEPASELGEDLLKLYVKPCCPDIDIFVDGKRFKAHRAILSARSSYFAAMLSGCWA
  ESSQEYVTLQGISHVELNVMMHFIYGGTLDIPDKTNVGQILNMADMYGLEGLKEVAIYIL
  RRDYCNFFQKPVPRTLTSILECLIIAHSVGVESLFADCMKWIVKHFARFWSERSFANIPP
  EIQKSCLNMLIQSLNDKNAAFLLMESDRLIISLPRVKWTEAALTMASQLQEKCIAFIVDN
  FSKIIQSENFALLLQSQAMSSTADLLDTILKAIEENITTENSCSLLMALDTLLNSDSTKE
  MGFTCKIQALRDKLWIFLVQSFYAVRHTESWKLMSTDDQQKIQAAAFDKGDDRRLGKKPI
  FSSSQQRKQVSDSGDIKIKSWRGNNKKECWSYLSTNKKMKSDGLGASGHSSSTNRNSINK
  TLKQDDVKEKDGTKIASKITKELKTGGKNVSGKPKTVTKSKTENGDKARLENMSPRQVVE
  RSATAAAAATGQKNLLNGKGVRNQEGQISGARPKVLTGNLNVQAKAKPLKKATGKDSPCL
  SIAGPSSRSTDSSMEFSISTECLDEPKENGSTEEEKPSGHKLSFCDSPGQMMKNSVDSVK
  NSTVAIKSRPVSRVTNGTSNKKSIHEQDTNVNNSVLKKVSGKGCSEPVPQAILKKRGTSN
  GCTAAQQRTKSTPSNLTKTQGSQGESPNSVKSSVSSRQSDENVAKLDHNTTTEKQAPKRK
  MVKQVHTALPKVNAKIVAMPKNLNQSKKGETLNNKDSKQKMPPGQVISKTQPSSQRPLKH
  ETSTVQKSMFHDVRDNNNKDSVSEQKPHKPLINLASEISDAEALQSSCRPDPQKPLNDQE
  KEKLALECQNISKLDKSLKHELESKQICLDKSETKFPNHKETDDCDAANICCHSVGSDNV
  NSKFYSTTALKYMVSNPNENSLNSNPVCDLDSTSAGQIHLISDRENQVGRKDTNKQSSIK
  CVEDVSLCNPERTNGTLNSAQEDKKSKVPVEGLTIPSKLSDESAMDEDKHATADSDVSSK
  CFSGQLSEKNSPKNMETSESPESHETPETPFVGHWNLSTGVLHQRESPESDTGSATTSSD
  DIKPRSEDYDAGGSQDDDGSNDRGISKCGTMLCHDFLGRSSSDTSTPEELKIYDSNLRIE
  VKMKKQSNNDLFQVNSTSDDEIPRKRPEIWSRSAIVHSRERENIPRGSVQFAQEIDQVSS
  SADETEDERSEAENVAENFSISNPAPQQFQGIINLAFEDATENECREFSATKKFKRSVLL
  SVDECEELGSDEGEVHTPFQASVDSFSPSDVFDGISHEHHGRTCYSRFSRESEDNILECK
  QNKGNSVCKNESTVLDLSSIDSSRKNKQSVSATEKKNTIDVLSSRSRQLLREDKKVNNGS
  NVENDIQQRSKFLDSDVKSQERPCHLDLHQREPNSDIPKNSSTKSLDSFRSQVLPQEGPV
  KESHSTTTEKANIALSAGDIDDCDTLAQTRMYDHRPSKTLSPIYEMDVIEAFEQKVESET
  HVTDMDFEDDQHFAKQDWTLLKQLLSEQDSNLDVTNSVPEDLSLAQYLINQTLLLARDSS
  KPQGITHIDTLNRWSELTSPLDSSASITMASFSSEDCSPQGEWTILELETQH
• Function: Involved in clathrin-mediated endocytosis at the synapse. Plays a role in neuronal development and in synaptic vesicle recycling in mature neurons, a process required for normal synaptic transmission.
• Tissue Specificity: Highly expressed in fetal brain. Weakly expressed in adult brain and prostate.

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Nervous system disease	DISJ7GGT	Definitive	Altered Expression	[1]
Subarachnoid hemorrhage	DISI7I8Y	Definitive	Biomarker	[2]
Acute leukaemia	DISDQFDI	Strong	Genetic Variation	[3]
Acute liver failure	DIS5EZKX	Strong	Biomarker	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Aortic aneurysm	DISQ5KRA	Strong	Biomarker	[6]
Brain neoplasm	DISY3EKS	Strong	Genetic Variation	[7]
Cardiac arrest	DIS9DIA4	Strong	Biomarker	[8]
Cardiac disease	DISVO1I5	Strong	Biomarker	[9]
Cardiac failure	DISDC067	Strong	Genetic Variation	[10]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[11]
Central diabetes insipidus	DISJ4P9O	Strong	Biomarker	[12]
Cerebral infarction	DISR1WNP	Strong	Biomarker	[13]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Genetic Variation	[14]
Coagulation defect	DIS9X3H6	Strong	Biomarker	[15]
Congestive heart failure	DIS32MEA	Strong	Genetic Variation	[10]
Coronary atherosclerosis	DISKNDYU	Strong	Genetic Variation	[16]
Coronary heart disease	DIS5OIP1	Strong	Genetic Variation	[16]
Depression	DIS3XJ69	Strong	Genetic Variation	[17]
Disseminated intravascular coagulation	DISCAVOZ	Strong	Genetic Variation	[18]
High blood pressure	DISY2OHH	Strong	Biomarker	[19]
HIV infectious disease	DISO97HC	Strong	Genetic Variation	[16]
Interstitial cystitis	DIS7CAJA	Strong	Biomarker	[20]
Kidney failure	DISOVQ9P	Strong	Genetic Variation	[21]
Leukopenia	DISJMBMM	Strong	Genetic Variation	[22]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[19]
Liver failure	DISLGEL6	Strong	Biomarker	[23]
Mental disorder	DIS3J5R8	Strong	Biomarker	[24]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[25]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[26]
Pancreatitis	DIS0IJEF	Strong	Biomarker	[27]
Respiratory disease	DISGGAGJ	Strong	Genetic Variation	[28]
Status epilepticus seizure	DISY3BIC	Strong	Biomarker	[29]
Substance abuse	DIS327VW	Strong	Genetic Variation	[30]
Thrombocytopenia	DISU61YW	Strong	Biomarker	[31]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[32]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[33]
Adult respiratory distress syndrome	DISIJV47	moderate	Biomarker	[34]
Alcohol dependence	DIS4ZSCO	moderate	Genetic Variation	[35]
Delirium	DIS2OKP1	moderate	Genetic Variation	[36]
Early-onset anterior polar cataract	DISTOPIY	moderate	Altered Expression	[37]
Inflammatory bowel disease	DISGN23E	moderate	Genetic Variation	[38]
Myocardial ischemia	DISFTVXF	moderate	Biomarker	[39]
Acute respiratory failure	DIS5KQ5Y	Limited	Genetic Variation	[40]
Influenza	DIS3PNU3	Limited	Biomarker	[41]
Methicillin-resistant staphylococci infection	DIS6DRDZ	Limited	Biomarker	[42]
Myocardial infarction	DIS655KI	Limited	Biomarker	[8]
Pneumocystis pneumonia	DISFSOM3	Limited	Genetic Variation	[21]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of BTB/POZ domain-containing protein 8 (BTBD8).	[43]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of BTB/POZ domain-containing protein 8 (BTBD8).	[44]
Melphalan	DMOLNHF	Approved	Melphalan decreases the expression of BTB/POZ domain-containing protein 8 (BTBD8).	[45]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of BTB/POZ domain-containing protein 8 (BTBD8).	[46]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of BTB/POZ domain-containing protein 8 (BTBD8).	[47]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of BTB/POZ domain-containing protein 8 (BTBD8).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of BTB/POZ domain-containing protein 8 (BTBD8).	[49]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of BTB/POZ domain-containing protein 8 (BTBD8).	[50]

References

• [1] Young Adults Among Patients Admitted to Polish Intensive Care Units in the Silesian ICU Registry.Med Sci Monit. 2019 Aug 2;25:5727-5737. doi: 10.12659/MSM.913852.
• [2] Early Transcranial Doppler Evaluation of Cerebral Autoregulation Independently Predicts Functional Outcome After Aneurysmal Subarachnoid Hemorrhage.Neurocrit Care. 2019 Oct;31(2):253-262. doi: 10.1007/s12028-019-00732-5.
• [3] Risk factors and coping strategies of severe community-acquired pneumonia in chemotherapy induction period of acute leukemia.Oncol Lett. 2018 Mar;15(3):3566-3571. doi: 10.3892/ol.2018.7731. Epub 2018 Jan 4.
• [4] The impact of real life treatment strategies for Candida peritonitis-A retrospective analysis.Mycoses. 2017 Jul;60(7):440-446. doi: 10.1111/myc.12615. Epub 2017 Apr 3.
• [5] The cancer control status and APACHE II score are prognostic factors for critically ill patients with cancer and sepsis.J Formos Med Assoc. 2020 Jan;119(1 Pt 2):276-281. doi: 10.1016/j.jfma.2019.05.012. Epub 2019 May 30.
• [6] Management of patients with acute aortic syndrome through a regional rapid transport system.J Vasc Surg. 2017 Jan;65(1):21-29. doi: 10.1016/j.jvs.2016.08.081. Epub 2016 Oct 1.
• [7] Risk factors and outcomes of severe acute respiratory failure requiring invasive mechanical ventilation in cancer patients: A retrospective cohort study.Med Intensiva (Engl Ed). 2018 Aug-Sep;42(6):354-362. doi: 10.1016/j.medin.2017.08.004. Epub 2017 Sep 28.
• [8] Long-term effects of brief hypoxia due to cardiac arrest: Hippocampal reductions and memory deficits.Resuscitation. 2018 May;126:65-71. doi: 10.1016/j.resuscitation.2018.02.016. Epub 2018 Feb 21.
• [9] Pneumonia caused by extensive drug-resistant Acinetobacter baumannii among hospitalized patients: genetic relationships, risk factors and mortality.BMC Infect Dis. 2017 May 30;17(1):371. doi: 10.1186/s12879-017-2471-0.
• [10] COPD patients hospitalized with exacerbations have greater cognitive impairment than patients hospitalized with decompensated heart failure.Clin Interv Aging. 2018 Dec 18;14:1-8. doi: 10.2147/CIA.S185981. eCollection 2019.
• [11] ICU-treated influenza A(H1N1) pdm09 infections more severe post pandemic than during 2009 pandemic: a retrospective analysis.BMC Infect Dis. 2017 Nov 21;17(1):728. doi: 10.1186/s12879-017-2829-3.
• [12] Risk factors and treatment outcomes of severe Clostridioides difficile infection in Singapore.Sci Rep. 2019 Sep 17;9(1):13440. doi: 10.1038/s41598-019-49794-7.
• [13] A Prospective Study of Comparing the Application of Two Generation Scoring Systems in Patients with Acute Cerebral Infarction.Adv Ther. 2019 Nov;36(11):3071-3078. doi: 10.1007/s12325-019-01084-4. Epub 2019 Sep 28.
• [14] APACHE-II score for anti-tuberculosis tolerance in critically ill patients: a retrospective study.BMC Infect Dis. 2019 Feb 4;19(1):106. doi: 10.1186/s12879-019-3751-7.
• [15] The reduced form of coagulation factor XI is associated with illness severity and coagulopathy in critically-ill septic patients.J Thromb Thrombolysis. 2019 Feb;47(2):186-191. doi: 10.1007/s11239-018-1797-9.
• [16] What determines do-not-resuscitate status in critically ill HIV-infected patients admitted to ICU?.J Crit Care. 2019 Oct;53:207-211. doi: 10.1016/j.jcrc.2019.06.010. Epub 2019 Jun 19.
• [17] Elevated modified shock index in early sepsis is associated with myocardial dysfunction and mortality.J Crit Care. 2018 Feb;43:30-35. doi: 10.1016/j.jcrc.2017.08.019. Epub 2017 Aug 12.
• [18] A multicenter, prospective evaluation of the Chinese Society of Thrombosis and Hemostasis Scoring System for disseminated intravascular coagulation.Thromb Res. 2019 Jan;173:131-140. doi: 10.1016/j.thromres.2018.11.022. Epub 2018 Nov 23.
• [19] Increased Healthcare-Associated Infections in a Surgical Intensive Care Unit Related to Boarding Non-Surgical Patients.Surg Infect (Larchmt). 2019 May/Jun;20(4):332-337. doi: 10.1089/sur.2018.240. Epub 2019 Feb 15.
• [20] Intracranial and Extracranial Injury Burden as Drivers of Impaired Cerebrovascular Reactivity in Traumatic Brain Injury.J Neurotrauma. 2018 Jul 15;35(14):1569-1577. doi: 10.1089/neu.2017.5595.
• [21] Pneumocystis jirovecii pneumonia (PCP) PCR-negative conversion predicts prognosis of HIV-negative patients with PCP and acute respiratory failure.PLoS One. 2018 Oct 25;13(10):e0206231. doi: 10.1371/journal.pone.0206231. eCollection 2018.
• [22] Impact of high MIC of fluconazole on outcomes of Candida glabrata bloodstream infection: a retrospective multicenter cohort study.Diagn Microbiol Infect Dis. 2018 Oct;92(2):127-132. doi: 10.1016/j.diagmicrobio.2018.05.001. Epub 2018 Jun 19.
• [23] Application of Accelerated Time Models to Compare Performance of Two Comorbidity-adjusting Methods with APACHE II in Predicting Short-term Mortality Among the Critically Ill.Methods Inf Med. 2018 Feb;57(1):81-88. doi: 10.3414/ME17-01-0097. Epub 2018 Apr 5.
• [24] Mapping of global scientific research in comorbidity and multimorbidity: A cross-sectional analysis.PLoS One. 2018 Jan 3;13(1):e0189091. doi: 10.1371/journal.pone.0189091. eCollection 2018.
• [25] Oncological patients admitted to an intensive care unit. Analysis of predictors of in-hospital mortality.Med Intensiva (Engl Ed). 2018 Aug-Sep;42(6):346-353. doi: 10.1016/j.medin.2018.02.001. Epub 2018 Mar 15.
• [26] Nonalcoholic fatty liver and the severity of acute pancreatitis.Eur J Intern Med. 2017 Mar;38:73-78. doi: 10.1016/j.ejim.2016.10.019. Epub 2016 Nov 5.
• [27] Concurrent Diabetic Ketoacidosis in Hypertriglyceridemia-Induced Pancreatitis: How Does It Affect the Clinical Course and Severity Scores?.Pancreas. 2017 Nov/Dec;46(10):1336-1340. doi: 10.1097/MPA.0000000000000937.
• [28] Low interferon-gamma release in response to phytohemagglutinin predicts the high severity of diseases.Medicine (Baltimore). 2019 May;98(22):e15843. doi: 10.1097/MD.0000000000015843.
• [29] Illness severity scoring in status epilepticus-When STESS meets APACHE II, SAPS II, and SOFA.Epilepsia. 2019 Feb;60(2):189-200. doi: 10.1111/epi.14623. Epub 2018 Dec 25.
• [30] Burden of Substance Abuse-Related Admissions to the Medical ICU.Chest. 2020 Jan;157(1):61-66. doi: 10.1016/j.chest.2019.08.2180. Epub 2019 Sep 5.
• [31] Risk factors for mortality in elderly and very elderly critically ill patients with sepsis: a prospective, observational, multicenter cohort study.Ann Intensive Care. 2019 Feb 4;9(1):26. doi: 10.1186/s13613-019-0495-x.
• [32] Prevalence and Risk Factors for Pressure Ulcers in Patients with Enterocutaneous Fistula: A Retrospective Single-Center Study in China.Med Sci Monit. 2019 Apr 9;25:2591-2598. doi: 10.12659/MSM.913261.
• [33] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [34] Older Adult Patients Are at Lower Risk of ARDS Compared to Younger Patients at Risk: Secondary Analysis of a Multicenter Cohort Study.J Intensive Care Med. 2020 Jan;35(1):42-47. doi: 10.1177/0885066619848357. Epub 2019 May 8.
• [35] Comparison of clinical efficacies and safeties of lumen-apposing metal stent and conventional-type metal stent-assisted EUS-guided pancreatic wall-off necrosis drainage: a real-life experience in a tertiary hospital.Surg Endosc. 2018 May;32(5):2448-2453. doi: 10.1007/s00464-017-5946-6. Epub 2017 Nov 3.
• [36] Functional Status in Older Intensive Care Unit Survivors.Clin Nurs Res. 2020 Jan;29(1):5-12. doi: 10.1177/1054773818785860. Epub 2018 Jul 19.
• [37] Lower long-term mortality in obese patients with community-acquired pneumonia: possible role of CRP.Clinics (Sao Paulo). 2019;74:e608. doi: 10.6061/clinics/2019/e608. Epub 2019 Jul 10.
• [38] Association analyses identify 38 susceptibility loci for inflammatory bowel disease and highlight shared genetic risk across populations.Nat Genet. 2015 Sep;47(9):979-986. doi: 10.1038/ng.3359. Epub 2015 Jul 20.
• [39] APpropriAteness of percutaneous Coronary interventions in patients with ischaemic HEart disease in Italy: the APACHE pilot study.BMJ Open. 2017 Sep 5;7(9):e016909. doi: 10.1136/bmjopen-2017-016909.
• [40] The -1082 interleukin-10 polymorphism is associated with acute respiratory failure after major trauma: a prospective cohort study.Surgery. 2008 Feb;143(2):233-42. doi: 10.1016/j.surg.2007.07.040. Epub 2007 Dec 27.
• [41] Invasive aspergillosis in patients admitted to the intensive care unit with severe influenza: a retrospective cohort study.Lancet Respir Med. 2018 Oct;6(10):782-792. doi: 10.1016/S2213-2600(18)30274-1. Epub 2018 Jul 31.
• [42] Predictors of septic shock in patients with methicillin-resistant Staphylococcus aureus bacteremia.Int J Infect Dis. 2012 Jun;16(6):e453-6. doi: 10.1016/j.ijid.2012.02.007. Epub 2012 Apr 11.
• [43] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [44] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [45] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [46] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [47] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [48] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [49] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [50] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.