Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3FQV7N)

• DOT Name: Syntabulin (SYBU)
• Synonyms: Golgi-localized syntaphilin-related protein; Syntaxin-1-binding protein
• Gene Name: SYBU
• Related Disease:
  Rheumatoid arthritis
  Acute myelogenous leukaemia
  Adult glioblastoma
  Alzheimer disease
  Autism spectrum disorder
  B-cell lymphoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cardiac failure
  Childhood acute lymphoblastic leukemia
  Chronic kidney disease
  Colon cancer
  Colon carcinoma
  Colorectal neoplasm
  Congestive heart failure
  Diabetic kidney disease
  Endometriosis
  Epilepsy
  Frontotemporal dementia
  Glioblastoma multiforme
  Glioma
  Hepatocellular carcinoma
  Lung adenocarcinoma
  Mental disorder
  Multiple sclerosis
  Myocardial infarction
  Neoplasm
  Nervous system inflammation
  Non-small-cell lung cancer
  Prostate cancer
  Prostate carcinoma
  Pulmonary fibrosis
  Systemic lupus erythematosus
  Tauopathy
  Epithelial ovarian cancer
  Melanoma
  Parkinson disease
  Squamous cell carcinoma
  Acute lymphocytic leukaemia
  Advanced cancer
  B-cell neoplasm
  Hepatitis C virus infection
  High blood pressure
  Nasopharyngeal carcinoma
  Osteoarthritis
  Pancreatic cancer
  Thyroid gland papillary carcinoma
  Type-1 diabetes
  Type-1/2 diabetes
• UniProt ID: SYBU_HUMAN
• Pfam ID: PF15290
• Sequence:
  MGPLRESKKEHRVQHHDKEISRSRIPRLILRPHMPQQQHKVSPASESPFSEEESREFNPS
  SSGRSARTVSSNSFCSDDTGCPSSQSVSPVKTPSDAGNSPIGFCPGSDEGFTRKKCTIGM
  VGEGSIQSSRYKKESKSGLVKPGSEADFSSSSSTGSISAPEVHMSTAGSKRSSSSRNRGP
  HGRSNGASSHKPGSSPSSPREKDLLSMLCRNQLSPVNIHPSYAPSSPSSSNSGSYKGSDC
  SPIMRRSGRYMSCGENHGVRPPNPEQYLTPLQQKEVTVRHLKTKLKESERRLHERESEIV
  ELKSQLARMREDWIEEECHRVEAQLALKEARKEIKQLKQVIETMRSSLADKDKGIQKYFV
  DINIQNKKLESLLQSMEMAHSGSLRDELCLDFPCDSPEKSLTLNPPLDTMADGLSLEEQV
  TGEGADRELLVGDSIANSTDLFDEIVTATTTESGDLELVHSTPGANVLELLPIVMGQEEG
  SVVVERAVQTDVVPYSPAISELIQSVLQKLQDPCPSSLASPDESEPDSMESFPESLSALV
  VDLTPRNPNSAILLSPVETPYANVDAEVHANRLMRELDFAACVEERLDGVIPLARGGVVR
  QYWSSSFLVDLLAVAAPVVPTVLWAFSTQRGGTDPVYNIGALLRGCCVVALHSLRRTAFR
  IKT
• Function: Part of a kinesin motor-adapter complex that is critical for the anterograde axonal transport of active zone components and contributes to activity-dependent presynaptic assembly during neuronal development.
• Tissue Specificity: Isoform 3, isoform 4 and isoform 5 are expressed in HeLa cell line (at protein level). Isoform 3 is expressed in fetal and adult brain. Isoform 4 is expressed in numerous fetal tissues (brain, kidney, liver, lung, and thymus) and in adult brain, kidney, liver, lung, pancreas, colon, prostate, small intestine, testis and thymus. Isoform 5 is expressed in fetal brain, brain and small intestine.

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Rheumatoid arthritis	DISTSB4J	Definitive	Biomarker	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[2]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[5]
B-cell lymphoma	DISIH1YQ	Strong	Altered Expression	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[8]
Cardiac failure	DISDC067	Strong	Biomarker	[9]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Altered Expression	[2]
Chronic kidney disease	DISW82R7	Strong	Altered Expression	[10]
Colon cancer	DISVC52G	Strong	Altered Expression	[11]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[11]
Colorectal neoplasm	DISR1UCN	Strong	Altered Expression	[12]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[9]
Diabetic kidney disease	DISJMWEY	Strong	Genetic Variation	[13]
Endometriosis	DISX1AG8	Strong	Biomarker	[14]
Epilepsy	DISBB28L	Strong	Biomarker	[15]
Frontotemporal dementia	DISKYHXL	Strong	Biomarker	[16]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[3]
Glioma	DIS5RPEH	Strong	Altered Expression	[17]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[18]
Lung adenocarcinoma	DISD51WR	Strong	Genetic Variation	[19]
Mental disorder	DIS3J5R8	Strong	Biomarker	[20]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[21]
Myocardial infarction	DIS655KI	Strong	Biomarker	[22]
Neoplasm	DISZKGEW	Strong	Biomarker	[23]
Nervous system inflammation	DISB3X5A	Strong	Biomarker	[24]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[25]
Prostate cancer	DISF190Y	Strong	Biomarker	[26]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[26]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[27]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[24]
Tauopathy	DISY2IPA	Strong	Biomarker	[28]
Epithelial ovarian cancer	DIS56MH2	moderate	Biomarker	[29]
Melanoma	DIS1RRCY	moderate	Biomarker	[30]
Parkinson disease	DISQVHKL	moderate	Biomarker	[24]
Squamous cell carcinoma	DISQVIFL	moderate	Altered Expression	[31]
Acute lymphocytic leukaemia	DISPX75S	Disputed	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[32]
B-cell neoplasm	DISVY326	Limited	Altered Expression	[33]
Hepatitis C virus infection	DISQ0M8R	Limited	Biomarker	[34]
High blood pressure	DISY2OHH	Limited	Biomarker	[35]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Biomarker	[36]
Osteoarthritis	DIS05URM	Limited	Biomarker	[37]
Pancreatic cancer	DISJC981	Limited	Altered Expression	[38]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Biomarker	[39]
Type-1 diabetes	DIS7HLUB	Limited	Biomarker	[40]
Type-1/2 diabetes	DISIUHAP	Limited	Altered Expression	[41]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Syntabulin (SYBU) affects the response to substance of Cisplatin.	[61]
Mitomycin	DMH0ZJE	Approved	Syntabulin (SYBU) affects the response to substance of Mitomycin.	[61]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Syntabulin (SYBU).	[42]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Syntabulin (SYBU).	[47]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Syntabulin (SYBU).	[55]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Syntabulin (SYBU).	[57]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Syntabulin (SYBU).	[43]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Syntabulin (SYBU).	[44]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Syntabulin (SYBU).	[45]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Syntabulin (SYBU).	[46]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Syntabulin (SYBU).	[48]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Syntabulin (SYBU).	[49]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Syntabulin (SYBU).	[50]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Syntabulin (SYBU).	[51]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Syntabulin (SYBU).	[52]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Syntabulin (SYBU).	[53]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Syntabulin (SYBU).	[54]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Syntabulin (SYBU).	[56]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Syntabulin (SYBU).	[58]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Syntabulin (SYBU).	[59]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Syntabulin (SYBU).	[60]

References

• [1] Arsenic Trioxide in Synergy with Vitamin D Rescues the Defective VDR-PPAR- Functional Module of Autophagy in Rheumatoid Arthritis.PPAR Res. 2019 May 7;2019:6403504. doi: 10.1155/2019/6403504. eCollection 2019.
• [2] Beclin-1 and hypoxia-inducible factor-1 genes expression: Potential biomarkers in acute leukemia patients.Cancer Biomark. 2016 Mar 18;16(4):619-26. doi: 10.3233/CBM-160603.
• [3] Sinomenine Hydrochloride Inhibits the Metastasis of Human Glioblastoma Cells by Suppressing the Expression of Matrix Metalloproteinase-2/-9 and Reversing the Endogenous and Exogenous Epithelial-Mesenchymal Transition.Int J Mol Sci. 2018 Mar 14;19(3):844. doi: 10.3390/ijms19030844.
• [4] Effect of site-specific amino acid D-isomerization on -sheet transition and fibril formation profiles of Tau microtubule-binding repeat peptides.Biochem Biophys Res Commun. 2019 Jan 1;508(1):184-190. doi: 10.1016/j.bbrc.2018.11.043. Epub 2018 Nov 22.
• [5] Role of Microtubule-Associated Protein in Autism Spectrum Disorder.Neurosci Bull. 2018 Dec;34(6):1119-1126. doi: 10.1007/s12264-018-0246-2. Epub 2018 Jun 23.
• [6] Tenovin-6 inhibits proliferation and survival of diffuse large B-cell lymphoma cells by blocking autophagy.Oncotarget. 2017 Feb 28;8(9):14912-14924. doi: 10.18632/oncotarget.14741.
• [7] High-mobility group box 1 released by autophagic cancer-associated fibroblasts maintains the stemness of luminal breast cancer cells.J Pathol. 2017 Nov;243(3):376-389. doi: 10.1002/path.4958. Epub 2017 Sep 21.
• [8] Improving breast cancer sensitivity to paclitaxel by increasing aneuploidy.Proc Natl Acad Sci U S A. 2019 Nov 19;116(47):23691-23697. doi: 10.1073/pnas.1910824116. Epub 2019 Nov 4.
• [9] Ultrastructure and regulation of lateralized connexin43 in the failing heart.Circ Res. 2010 Apr 2;106(6):1153-63. doi: 10.1161/CIRCRESAHA.108.182147. Epub 2010 Feb 18.
• [10] Hyperphosphatemia induces protective autophagy in endothelial cells through the inhibition of Akt/mTOR signaling.J Vasc Surg. 2015 Jul;62(1):210-221.e2. doi: 10.1016/j.jvs.2014.02.040. Epub 2014 May 3.
• [11] TPX2 is a novel prognostic marker for the growth and metastasis of colon cancer.J Transl Med. 2013 Dec 17;11:313. doi: 10.1186/1479-5876-11-313.
• [12] Expression of the microtubule-associated protein MAP9/ASAP and its partners AURKA and PLK1 in colorectal and breast cancers.Dis Markers. 2014;2014:798170. doi: 10.1155/2014/798170. Epub 2014 Apr 30.
• [13] Evaluation of urinary autophagy transcripts expression in diabetic kidney disease.J Diabetes Complications. 2017 Oct;31(10):1491-1498. doi: 10.1016/j.jdiacomp.2017.06.009. Epub 2017 Jun 27.
• [14] Expression and significance of autophagy genes LC3, Beclin1 and MMP-2 in endometriosis.Exp Ther Med. 2018 Sep;16(3):1958-1962. doi: 10.3892/etm.2018.6362. Epub 2018 Jun 27.
• [15] Tau Related Pathways as a Connecting Link between Epilepsy and Alzheimer's Disease.ACS Chem Neurosci. 2019 Oct 16;10(10):4199-4212. doi: 10.1021/acschemneuro.9b00460. Epub 2019 Sep 30.
• [16] Tau in neurodegenerative disease.Ann Transl Med. 2018 May;6(10):175. doi: 10.21037/atm.2018.04.23.
• [17] AMPK-dependent autophagy upregulation serves as a survival mechanism in response to Tumor Treating Fields (TTFields).Cell Death Dis. 2018 Oct 19;9(11):1074. doi: 10.1038/s41419-018-1085-9.
• [18] Suppressor of hepatocellular carcinoma RASSF1A activates autophagy initiation and maturation.Cell Death Differ. 2019 Aug;26(8):1379-1395. doi: 10.1038/s41418-018-0211-7. Epub 2018 Oct 12.
• [19] The human Bcl-2 family member Bcl-rambo and voltage-dependent anion channels manifest a genetic interaction in Drosophila and cooperatively promote the activation of effector caspases in human cultured cells.Exp Cell Res. 2019 Aug 15;381(2):223-234. doi: 10.1016/j.yexcr.2019.05.015. Epub 2019 May 15.
• [20] Microtubule and microtubule associated protein anomalies in psychiatric disease.Cytoskeleton (Hoboken). 2016 Oct;73(10):596-611. doi: 10.1002/cm.21300. Epub 2016 May 20.
• [21] Sex-specific Tau methylation patterns and synaptic transcriptional alterations are associated with neural vulnerability during chronic neuroinflammation.J Autoimmun. 2019 Jul;101:56-69. doi: 10.1016/j.jaut.2019.04.003. Epub 2019 Apr 19.
• [22] Alterations of autophagic-lysosomal system in the peripheral leukocytes of patients with myocardial infarction.Clin Chim Acta. 2011 Aug 17;412(17-18):1567-71. doi: 10.1016/j.cca.2011.05.002. Epub 2011 May 7.
• [23] Dual-functionality of RASSF1A overexpression in A375 cells is mediated by activation of IL-6/STAT3 regulatory loop.Mol Biol Rep. 2018 Oct;45(5):1277-1287. doi: 10.1007/s11033-018-4288-3. Epub 2018 Aug 3.
• [24] Autophagy: a potential key contributor to the therapeutic action of mesenchymal stem cells.Autophagy. 2020 Jan;16(1):28-37. doi: 10.1080/15548627.2019.1630223. Epub 2019 Jun 18.
• [25] AZD9291 promotes autophagy and inhibits PI3K/Akt pathway in NSCLC cancer cells. J Cell Biochem. 2019 Jan;120(1):756-767. doi: 10.1002/jcb.27434. Epub 2018 Aug 26.
• [26] A novel role for MAP1 LC3 in nonautophagic cytoplasmic vacuolation death of cancer cells.Oncogene. 2009 Jul 16;28(28):2556-68. doi: 10.1038/onc.2009.118. Epub 2009 May 18.
• [27] Beclin 1, LC3, and p62 expression in paraquat-induced pulmonary fibrosis.Hum Exp Toxicol. 2019 Jul;38(7):794-802. doi: 10.1177/0960327119842633. Epub 2019 Apr 12.
• [28] Why Microtubules Should Be Considered as One of the Supplementary Targets for Designing Neurotherapeutics.ACS Chem Neurosci. 2019 Mar 20;10(3):1118-1120. doi: 10.1021/acschemneuro.9b00002. Epub 2019 Jan 18.
• [29] Decreased expression of autophagy-related proteins in malignant epithelial ovarian cancer.Autophagy. 2008 Nov;4(8):1067-8. doi: 10.4161/auto.6827. Epub 2008 Nov 20.
• [30] JWA inhibits melanoma angiogenesis by suppressing ILK signaling and is an independent prognostic biomarker for melanoma.Carcinogenesis. 2013 Dec;34(12):2778-88. doi: 10.1093/carcin/bgt318. Epub 2013 Sep 24.
• [31] Overexpression of the receptor for hyaluronan-mediated motility, correlates with expression of microtubule-associated protein in human oral squamous cell carcinomas.Int J Oncol. 2009 Jun;34(6):1565-71. doi: 10.3892/ijo_00000286.
• [32] The prognostic value of theTau protein serum level in metastatic breast cancer patients and its correlation with brain metastases.BMC Cancer. 2019 Jan 30;19(1):110. doi: 10.1186/s12885-019-5287-z.
• [33] Streptozotocin-Induced Autophagy Reduces Intracellular Insulin in Insulinoma INS-1E Cells.DNA Cell Biol. 2018 Mar;37(3):160-167. doi: 10.1089/dna.2017.3874. Epub 2018 Feb 27.
• [34] Autophagy protects cells from HCV-induced defects in lipid metabolism.Gastroenterology. 2012 Mar;142(3):644-653.e3. doi: 10.1053/j.gastro.2011.11.033. Epub 2011 Dec 7.
• [35] Pharmacological restoration of autophagy reduces hypertension-related stroke occurrence.Autophagy. 2020 Aug;16(8):1468-1481. doi: 10.1080/15548627.2019.1687215. Epub 2019 Nov 12.
• [36] Prognostic value of TIGAR and LC3B protein expression in nasopharyngeal carcinoma.Cancer Manag Res. 2018 Nov 12;10:5605-5616. doi: 10.2147/CMAR.S175501. eCollection 2018.
• [37] Autophagy promotes citrullination of VIM (vimentin) and its interaction with major histocompatibility complex class II in synovial fibroblasts.Autophagy. 2020 May;16(5):946-955. doi: 10.1080/15548627.2019.1664144. Epub 2019 Sep 8.
• [38] Autophagy Is Required for Activation of Pancreatic Stellate Cells, Associated With Pancreatic Cancer Progression and Promotes Growth of Pancreatic Tumors in Mice.Gastroenterology. 2017 May;152(6):1492-1506.e24. doi: 10.1053/j.gastro.2017.01.010. Epub 2017 Jan 23.
• [39] Expression of autophagy-associated proteins in papillary thyroid carcinoma.Oncol Lett. 2017 Jul;14(1):411-415. doi: 10.3892/ol.2017.6101. Epub 2017 Apr 28.
• [40] Recurrent nonsevere hypoglycemia exacerbates imbalance of mitochondrial homeostasis leading to synapse injury and cognitive deficit in diabetes.Am J Physiol Endocrinol Metab. 2018 Nov 1;315(5):E973-E986. doi: 10.1152/ajpendo.00133.2018. Epub 2018 Jul 3.
• [41] Lycium barbarum polysaccharide protects diabetic peripheral neuropathy by enhancing autophagy via mTOR/p70S6K inhibition in Streptozotocin-induced diabetic rats.J Chem Neuroanat. 2018 Apr;89:37-42. doi: 10.1016/j.jchemneu.2017.12.011. Epub 2017 Dec 30.
• [42] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [43] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [44] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [45] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [46] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [47] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [48] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [49] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [50] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [51] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [52] Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.
• [53] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [54] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [55] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [56] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [57] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [58] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [59] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [60] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
• [61] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.