Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBBF28C)

• DOT Name: Ras-related protein R-Ras (RRAS)
• Synonyms: EC 3.6.5.-; p23
• Gene Name: RRAS
• Related Disease:
  Neoplasm
  Acute myelogenous leukaemia
  Adenoma
  Advanced cancer
  Alzheimer disease
  Atrial fibrillation
  B-cell neoplasm
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Castration-resistant prostate carcinoma
  Cervical cancer
  Cervical carcinoma
  Childhood acute lymphoblastic leukemia
  Chronic myelomonocytic leukaemia
  Colorectal adenoma
  Colorectal carcinoma
  Diabetic kidney disease
  Esophageal squamous cell carcinoma
  Essential hypertension
  Fibrosarcoma
  Gastric cancer
  Glioblastoma multiforme
  Hepatitis C virus infection
  Huntington disease
  Lung adenocarcinoma
  Neoplasm of esophagus
  Non-insulin dependent diabetes
  Obesity
  Parkinson disease
  Prostate carcinoma
  Prostate neoplasm
  Retinoblastoma
  Squamous cell carcinoma
  Stomach cancer
  High blood pressure
  Nasopharyngeal carcinoma
  Noonan syndrome
  Prostate cancer
  Autoimmune disease
  Carcinoma
  leukaemia
  Leukemia
  Lung cancer
  Lung carcinoma
  Melanoma
  Osteoarthritis
  Rheumatoid arthritis
  Thyroid tumor
• UniProt ID: RRAS_HUMAN
• PDB ID: 2FN4; 7S0Z
• EC Number: 3.6.5.-
• Pfam ID: PF00071
• Sequence:
  MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP
  TIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG
  KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVD
  EAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL
• Function: Regulates the organization of the actin cytoskeleton. With OSPBL3, modulates integrin beta-1 (ITGB1) activity.
• KEGG Pathway:
  MAPK sig.ling pathway (hsa04010)
  Ras sig.ling pathway (hsa04014)
  Rap1 sig.ling pathway (hsa04015)
  cAMP sig.ling pathway (hsa04024)
  Phospholipase D sig.ling pathway (hsa04072)
  Mitophagy - animal (hsa04137)
  Autophagy - animal (hsa04140)
  Cellular senescence (hsa04218)
  Axon guidance (hsa04360)
  Apelin sig.ling pathway (hsa04371)
  C-type lectin receptor sig.ling pathway (hsa04625)
  Regulation of actin cytoskeleton (hsa04810)
  Salmonella infection (hsa05132)
  Proteoglycans in cancer (hsa05205)
• Reactome Pathway:
  Sema4D mediated inhibition of cell attachment and migration (R-HSA-416550)
  SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion (R-HSA-399955)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Genetic Variation	[2]
Adenoma	DIS78ZEV	Strong	Biomarker	[3]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[4]
Alzheimer disease	DISF8S70	Strong	Biomarker	[5]
Atrial fibrillation	DIS15W6U	Strong	Genetic Variation	[6]
B-cell neoplasm	DISVY326	Strong	Biomarker	[7]
Breast cancer	DIS7DPX1	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[8]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[9]
Castration-resistant prostate carcinoma	DISVGAE6	Strong	Biomarker	[10]
Cervical cancer	DISFSHPF	Strong	Biomarker	[11]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[11]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Altered Expression	[12]
Chronic myelomonocytic leukaemia	DISDN5P7	Strong	Biomarker	[13]
Colorectal adenoma	DISTSVHM	Strong	Altered Expression	[14]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[15]
Diabetic kidney disease	DISJMWEY	Strong	Genetic Variation	[16]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[17]
Essential hypertension	DIS7WI98	Strong	Genetic Variation	[18]
Fibrosarcoma	DISWX7MU	Strong	Biomarker	[19]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[20]
Glioblastoma multiforme	DISK8246	Strong	Genetic Variation	[21]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[22]
Huntington disease	DISQPLA4	Strong	Altered Expression	[23]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[24]
Neoplasm of esophagus	DISOLKAQ	Strong	Genetic Variation	[25]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Altered Expression	[26]
Obesity	DIS47Y1K	Strong	Genetic Variation	[27]
Parkinson disease	DISQVHKL	Strong	Biomarker	[28]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[29]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[30]
Retinoblastoma	DISVPNPB	Strong	Biomarker	[31]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[3]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[20]
High blood pressure	DISY2OHH	moderate	Genetic Variation	[32]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Posttranslational Modification	[33]
Noonan syndrome	DIS7Q7DN	Moderate	Autosomal dominant	[2]
Prostate cancer	DISF190Y	moderate	Altered Expression	[29]
Autoimmune disease	DISORMTM	Limited	Biomarker	[34]
Carcinoma	DISH9F1N	Limited	Altered Expression	[35]
leukaemia	DISS7D1V	Limited	Biomarker	[34]
Leukemia	DISNAKFL	Limited	Biomarker	[34]
Lung cancer	DISCM4YA	Limited	Biomarker	[36]
Lung carcinoma	DISTR26C	Limited	Biomarker	[36]
Melanoma	DIS1RRCY	Limited	Altered Expression	[1]
Osteoarthritis	DIS05URM	Limited	Biomarker	[37]
Rheumatoid arthritis	DISTSB4J	Limited	Biomarker	[37]
Thyroid tumor	DISLVKMD	Limited	Biomarker	[35]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Ras-related protein R-Ras (RRAS) affects the response to substance of Fluorouracil.	[60]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Ras-related protein R-Ras (RRAS).	[38]
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Ras-related protein R-Ras (RRAS).	[45]

23 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Ras-related protein R-Ras (RRAS).	[39]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Ras-related protein R-Ras (RRAS).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Ras-related protein R-Ras (RRAS).	[41]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Ras-related protein R-Ras (RRAS).	[42]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Ras-related protein R-Ras (RRAS).	[43]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Ras-related protein R-Ras (RRAS).	[44]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Ras-related protein R-Ras (RRAS).	[46]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Ras-related protein R-Ras (RRAS).	[47]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Ras-related protein R-Ras (RRAS).	[48]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Ras-related protein R-Ras (RRAS).	[49]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Ras-related protein R-Ras (RRAS).	[50]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Ras-related protein R-Ras (RRAS).	[49]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Ras-related protein R-Ras (RRAS).	[51]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Ras-related protein R-Ras (RRAS).	[42]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Ras-related protein R-Ras (RRAS).	[52]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Ras-related protein R-Ras (RRAS).	[53]
Dactinomycin	DM2YGNW	Approved	Dactinomycin increases the expression of Ras-related protein R-Ras (RRAS).	[53]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Ras-related protein R-Ras (RRAS).	[54]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Ras-related protein R-Ras (RRAS).	[55]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Ras-related protein R-Ras (RRAS).	[56]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Ras-related protein R-Ras (RRAS).	[57]
Glyphosate	DM0AFY7	Investigative	Glyphosate increases the expression of Ras-related protein R-Ras (RRAS).	[58]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of Ras-related protein R-Ras (RRAS).	[59]

References

• [1] Inactivation of RASA1 promotes melanoma tumorigenesis via R-Ras activation.Oncotarget. 2016 Apr 26;7(17):23885-96. doi: 10.18632/oncotarget.8127.
• [2] Activating mutations in RRAS underlie a phenotype within the RASopathy spectrum and contribute to leukaemogenesis. Hum Mol Genet. 2014 Aug 15;23(16):4315-27. doi: 10.1093/hmg/ddu148. Epub 2014 Apr 4.
• [3] The possible mechanism of enhanced carcinogenesis induced by genotoxic carcinogens in rasH2 mice.Cancer Lett. 2007 Jan 8;245(1-2):321-30. doi: 10.1016/j.canlet.2006.01.025. Epub 2006 Mar 13.
• [4] Down-Regulation of p23 in Normal Lung Epithelial Cells Reduces Toxicities From Exposure to Benzo[a]pyrene and Cigarette Smoke Condensate via an Aryl Hydrocarbon Receptor-Dependent Mechanism.Toxicol Sci. 2019 Jan 1;167(1):239-248. doi: 10.1093/toxsci/kfy234.
• [5] The small chaperone protein p23 and its cleaved product p19 in cellular stress.J Mol Neurosci. 2012 Feb;46(2):303-14. doi: 10.1007/s12031-011-9574-7. Epub 2011 Jun 21.
• [6] Renin-angiotensin system-related gene polymorphisms are associated with risk of atrial fibrillation.Am Heart J. 2010 Sep;160(3):496-505. doi: 10.1016/j.ahj.2010.06.013.
• [7] Nox4 is involved in high glucose-induced apoptosis in renal tubular epithelial cells via Notch pathway.Mol Med Rep. 2017 Jun;15(6):4319-4325. doi: 10.3892/mmr.2017.6516. Epub 2017 Apr 26.
• [8] The Ras-related gene ERAS is involved in human and murine breast cancer.Sci Rep. 2018 Aug 29;8(1):13038. doi: 10.1038/s41598-018-31326-4.
• [9] High levels of Hsp90 cochaperone p23 promote tumor progression and poor prognosis in breast cancer by increasing lymph node metastases and drug resistance.Cancer Res. 2010 Nov 1;70(21):8446-56. doi: 10.1158/0008-5472.CAN-10-1590. Epub 2010 Sep 16.
• [10] Preclinical toxicology and toxicokinetic evaluation of ailanthone, a natural product against castration-resistant prostate cancer, in mice.Fitoterapia. 2019 Jul;136:104161. doi: 10.1016/j.fitote.2019.04.016. Epub 2019 Apr 30.
• [11] EphB2 promotes cervical cancer progression by inducing epithelial-mesenchymal transition.Hum Pathol. 2014 Feb;45(2):372-81. doi: 10.1016/j.humpath.2013.10.001. Epub 2013 Oct 18.
• [12] miRNA mediated up-regulation of cochaperone p23 acts as an anti-apoptotic factor in childhood acute lymphoblastic leukemia.Leuk Res. 2012 Sep;36(9):1098-104. doi: 10.1016/j.leukres.2012.05.003. Epub 2012 Jun 6.
• [13] The genomic landscape of juvenile myelomonocytic leukemia.Nat Genet. 2015 Nov;47(11):1326-1333. doi: 10.1038/ng.3400. Epub 2015 Oct 12.
• [14] Molecular mechanisms underlying the tumorigenesis of colorectal adenomas: correlation to activated K-ras oncogene.Oncol Rep. 2006 Dec;16(6):1245-52.
• [15] km23-1/DYNLRB1 regulation of MEK/ERK signaling and R-Ras in invasive human colorectal cancer cells.Cell Biol Int. 2020 Jan;44(1):155-165. doi: 10.1002/cbin.11215. Epub 2019 Aug 28.
• [16] Engulfment and cell motility protein 1 potentiates diabetic cardiomyopathy via Rac-dependent and Rac-independent ROS production.JCI Insight. 2019 Jun 20;4(12):e127660. doi: 10.1172/jci.insight.127660. eCollection 2019 Jun 20.
• [17] Effects of PLCE1 gene silencing by RNA interference on cell cycling and apoptosis in esophageal carcinoma cells.Asian Pac J Cancer Prev. 2014;15(13):5437-42. doi: 10.7314/apjcp.2014.15.13.5437.
• [18] Serum concentration of renin-angiotensin system components in association with ACE I/D polymorphism among hypertensive subjects in response to ACE inhibitor therapy.Clin Exp Hypertens. 2019;41(7):662-669. doi: 10.1080/10641963.2018.1529782. Epub 2018 Oct 11.
• [19] Heterologous expression and characterization of the human R-ras gene product.Mol Cell Biol. 1987 Aug;7(8):2845-56. doi: 10.1128/mcb.7.8.2845-2856.1987.
• [20] Discovery of aberrant expression of R-RAS by cancer-linked DNA hypomethylation in gastric cancer using microarrays.Cancer Res. 2005 Mar 15;65(6):2115-24. doi: 10.1158/0008-5472.CAN-04-3340.
• [21] Alterations of the RRAS and ERCC1 genes at 19q13 in gemistocytic astrocytomas.J Neuropathol Exp Neurol. 2014 Oct;73(10):908-15. doi: 10.1097/NEN.0000000000000110.
• [22] Processing of hepatitis C virus core protein is regulated by its C-terminal sequence.J Med Virol. 2003 Mar;69(3):357-66. doi: 10.1002/jmv.10297.
• [23] A genome-scale RNA-interference screen identifies RRAS signaling as a pathologic feature of Huntington's disease.PLoS Genet. 2012;8(11):e1003042. doi: 10.1371/journal.pgen.1003042. Epub 2012 Nov 29.
• [24] Docosahexaenoic Acid-mediated Inhibition of Heat Shock Protein 90-p23 Chaperone Complex and Downstream Client Proteins in Lung and Breast Cancer.Nutr Cancer. 2017 Jan;69(1):92-104. doi: 10.1080/01635581.2017.1247886. Epub 2016 Nov 23.
• [25] Germline sequence variants of the LZTS1 gene are associated with prostate cancer risk.Cancer Genet Cytogenet. 2002 Aug;137(1):1-7. doi: 10.1016/s0165-4608(02)00549-6.
• [26] Ras associated with diabetes may play a role in fracture nonunion development in rats.BMC Musculoskelet Disord. 2019 Dec 12;20(1):602. doi: 10.1186/s12891-019-2970-9.
• [27] Contributions of renin-angiotensin system-related gene interactions to obesity in a Chinese population.PLoS One. 2012;7(8):e42881. doi: 10.1371/journal.pone.0042881. Epub 2012 Aug 6.
• [28] Hsp90 Co-chaperone p23 contributes to dopaminergic mitochondrial stress via stabilization of PHD2: Implications for Parkinson's disease.Neurotoxicology. 2018 Mar;65:166-173. doi: 10.1016/j.neuro.2018.02.012. Epub 2018 Feb 20.
• [29] The co-chaperone p23 promotes prostate cancer motility and metastasis.Mol Oncol. 2015 Jan;9(1):295-308. doi: 10.1016/j.molonc.2014.08.014. Epub 2014 Sep 6.
• [30] Identification of genes potentially involved in the acquisition of androgen-independent and metastatic tumor growth in an autochthonous genetically engineered mouse prostate cancer model.Prostate. 2007 Jan 1;67(1):83-106. doi: 10.1002/pros.20505.
• [31] pRb controls estrogen receptor alpha protein stability and activity.Oncotarget. 2013 Jun;4(6):875-83. doi: 10.18632/oncotarget.1036.
• [32] Trans-ancestry meta-analyses identify rare and common variants associated with blood pressure and hypertension.Nat Genet. 2016 Oct;48(10):1151-1161. doi: 10.1038/ng.3654. Epub 2016 Sep 12.
• [33] Promoter hypermethylation of Ras-related GTPase gene RRAD inactivates a tumor suppressor function in nasopharyngeal carcinoma.Cancer Lett. 2012 Oct 28;323(2):147-54. doi: 10.1016/j.canlet.2012.03.042. Epub 2012 Apr 6.
• [34] FAS and RAS related Apoptosis defects: From autoimmunity to leukemia.Immunol Rev. 2019 Jan;287(1):50-61. doi: 10.1111/imr.12720.
• [35] Function of HSP90 and p23 in the telomerase complex of thyroid tumors.Pathol Res Pract. 2003;199(9):573-9. doi: 10.1078/0344-0338-00464.
• [36] A precision-guided MWNT mediated reawakening the sunk synergy in RAS for anti-angiogenesis lung cancer therapy.Biomaterials. 2017 Sep;139:75-90. doi: 10.1016/j.biomaterials.2017.05.046. Epub 2017 May 31.
• [37] Differential Expression of Renin-Angiotensin System-related Components in Patients with Rheumatoid Arthritis and Osteoarthritis.Am J Med Sci. 2020 Jan;359(1):17-26. doi: 10.1016/j.amjms.2019.10.014. Epub 2019 Nov 5.
• [38] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [39] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [40] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [41] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [42] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [43] Gene expression profiling reveals novel regulation by bisphenol-A in estrogen receptor-alpha-positive human cells. Environ Res. 2006 Jan;100(1):86-92.
• [44] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [45] Effect of prenatal arsenic exposure on DNA methylation and leukocyte subpopulations in cord blood. Epigenetics. 2014 May;9(5):774-82. doi: 10.4161/epi.28153. Epub 2014 Feb 13.
• [46] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [47] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [48] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [49] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [50] Proteomic analysis revealed association of aberrant ROS signaling with suberoylanilide hydroxamic acid-induced autophagy in Jurkat T-leukemia cells. Autophagy. 2010 Aug;6(6):711-24. doi: 10.4161/auto.6.6.12397. Epub 2010 Aug 17.
• [51] Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
• [52] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [53] Genomic profiling uncovers a molecular pattern for toxicological characterization of mutagens and promutagens in vitro. Toxicol Sci. 2011 Jul;122(1):185-97.
• [54] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [55] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [56] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [57] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [58] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
• [59] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [60] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.