Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBFALJD)

DOT Name Cytochrome c (CYCS)
Gene Name CYCS
Related Disease
Choriocarcinoma ( )
Frontotemporal dementia ( )
Advanced cancer ( )
Alzheimer disease ( )
Anca-associated vasculitis ( )
Anti-neutrophil cytoplasmic antibody-associated vasculitis ( )
Behcet disease ( )
Bloom syndrome ( )
Brain ischaemia ( )
Breast cancer ( )
Breast carcinoma ( )
Chediak-Higashi syndrome ( )
Chondrosarcoma ( )
Diffuse systemic sclerosis ( )
Fatty liver disease ( )
Head and neck neoplasm ( )
Hereditary hyperferritinemia with congenital cataracts ( )
Idiopathic inflammatory myopathy ( )
Inherited bleeding disorder, platelet-type ( )
Leukopenia ( )
Obesity ( )
Retinitis pigmentosa ( )
Scleroderma ( )
Systemic lupus erythematosus ( )
Systemic sclerosis ( )
Thrombocytopenia ( )
Thrombocytopenia 4 ( )
Vasculitis ( )
Obsolete autosomal thrombocytopenia with normal platelets ( )
Cystinuria ( )
Hypotonia-cystinuria syndrome ( )
Ischemia ( )
Lupus nephritis ( )
Methylmalonic acidemia ( )
Rheumatoid arthritis ( )
UniProt ID
CYC_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1J3S; 2N3Y; 2N9I; 2N9J; 3NWV; 3ZCF; 3ZOO; 5EXQ; 5O10; 5TY3; 6DUJ; 6ECJ; 6XNK
Pfam ID
PF00034
Sequence
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Function
Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.; Plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases.
KEGG Pathway
Oxidative phosphorylation (hsa00190 )
Metabolic pathways (hsa01100 )
Platinum drug resistance (hsa01524 )
p53 sig.ling pathway (hsa04115 )
Apoptosis (hsa04210 )
Apoptosis - multiple species (hsa04215 )
Non-alcoholic fatty liver disease (hsa04932 )
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )
Amyotrophic lateral sclerosis (hsa05014 )
Huntington disease (hsa05016 )
Spinocerebellar ataxia (hsa05017 )
Prion disease (hsa05020 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Pathogenic Escherichia coli infection (hsa05130 )
Shigellosis (hsa05131 )
Salmonella infection (hsa05132 )
Legionellosis (hsa05134 )
Toxoplasmosis (hsa05145 )
Tuberculosis (hsa05152 )
Hepatitis C (hsa05160 )
Hepatitis B (hsa05161 )
Measles (hsa05162 )
Human cytomegalovirus infection (hsa05163 )
Influenza A (hsa05164 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Herpes simplex virus 1 infection (hsa05168 )
Epstein-Barr virus infection (hsa05169 )
Human immunodeficiency virus 1 infection (hsa05170 )
Pathways in cancer (hsa05200 )
Colorectal cancer (hsa05210 )
Small cell lung cancer (hsa05222 )
Viral myocarditis (hsa05416 )
Lipid and atherosclerosis (hsa05417 )
Reactome Pathway
Formation of apoptosome (R-HSA-111458 )
Activation of caspases through apoptosome-mediated cleavage (R-HSA-111459 )
SMAC (DIABLO) binds to IAPs (R-HSA-111463 )
SMAC(DIABLO)-mediated dissociation of IAP (R-HSA-111464 )
Transcriptional activation of mitochondrial biogenesis (R-HSA-2151201 )
Detoxification of Reactive Oxygen Species (R-HSA-3299685 )
Pyroptosis (R-HSA-5620971 )
TP53 Regulates Metabolic Genes (R-HSA-5628897 )
Respiratory electron transport (R-HSA-611105 )
Regulation of the apoptosome activity (R-HSA-9627069 )
Cytoprotection by HMOX1 (R-HSA-9707564 )
Release of apoptotic factors from the mitochondria (R-HSA-111457 )
BioCyc Pathway
MetaCyc:ENSG00000172115-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

35 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Choriocarcinoma DISDBVNL Definitive Altered Expression [1]
Frontotemporal dementia DISKYHXL Definitive Biomarker [2]
Advanced cancer DISAT1Z9 Strong Genetic Variation [3]
Alzheimer disease DISF8S70 Strong Genetic Variation [4]
Anca-associated vasculitis DISU3CNU Strong Genetic Variation [5]
Anti-neutrophil cytoplasmic antibody-associated vasculitis DISBEQIT Strong Biomarker [6]
Behcet disease DISSYMBS Strong Biomarker [3]
Bloom syndrome DISKXQ7J Strong Biomarker [3]
Brain ischaemia DIS9Q4RT Strong Biomarker [7]
Breast cancer DIS7DPX1 Strong Biomarker [8]
Breast carcinoma DIS2UE88 Strong Biomarker [8]
Chediak-Higashi syndrome DISPJLLO Strong Biomarker [9]
Chondrosarcoma DIS4I7JB Strong Biomarker [10]
Diffuse systemic sclerosis DISYF5LP Strong Biomarker [11]
Fatty liver disease DIS485QZ Strong Biomarker [12]
Head and neck neoplasm DIS1OB2G Strong Biomarker [13]
Hereditary hyperferritinemia with congenital cataracts DISGL689 Strong Altered Expression [14]
Idiopathic inflammatory myopathy DISGB1BZ Strong Biomarker [15]
Inherited bleeding disorder, platelet-type DISIUNXT Strong Biomarker [16]
Leukopenia DISJMBMM Strong Biomarker [17]
Obesity DIS47Y1K Strong Biomarker [18]
Retinitis pigmentosa DISCGPY8 Strong Biomarker [19]
Scleroderma DISVQ342 Strong Biomarker [20]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [21]
Systemic sclerosis DISF44L6 Strong Biomarker [20]
Thrombocytopenia DISU61YW Strong Genetic Variation [22]
Thrombocytopenia 4 DISG0ROB Strong Autosomal dominant [23]
Vasculitis DISQRKDX Strong Biomarker [3]
Obsolete autosomal thrombocytopenia with normal platelets DISHFIE8 Supportive Autosomal dominant [23]
Cystinuria DISCU7CO Limited Biomarker [24]
Hypotonia-cystinuria syndrome DISUPMRI Limited Genetic Variation [24]
Ischemia DIS5XOOY Limited Biomarker [25]
Lupus nephritis DISCVGPZ Limited Biomarker [26]
Methylmalonic acidemia DISHY8VB Limited Biomarker [27]
Rheumatoid arthritis DISTSB4J Limited Biomarker [28]
------------------------------------------------------------------------------------
⏷ Show the Full List of 35 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
49 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Cytochrome c (CYCS). [29]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Cytochrome c (CYCS). [30]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Cytochrome c (CYCS). [31]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Cytochrome c (CYCS). [32]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Cytochrome c (CYCS). [33]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Cytochrome c (CYCS). [34]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Cytochrome c (CYCS). [35]
Quercetin DM3NC4M Approved Quercetin increases the expression of Cytochrome c (CYCS). [37]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Cytochrome c (CYCS). [38]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Cytochrome c (CYCS). [40]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Cytochrome c (CYCS). [41]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Cytochrome c (CYCS). [42]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Cytochrome c (CYCS). [43]
Marinol DM70IK5 Approved Marinol decreases the expression of Cytochrome c (CYCS). [44]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Cytochrome c (CYCS). [45]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the expression of Cytochrome c (CYCS). [46]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of Cytochrome c (CYCS). [47]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of Cytochrome c (CYCS). [48]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of Cytochrome c (CYCS). [50]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Cytochrome c (CYCS). [51]
Paclitaxel DMLB81S Approved Paclitaxel increases the expression of Cytochrome c (CYCS). [54]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of Cytochrome c (CYCS). [41]
Daunorubicin DMQUSBT Approved Daunorubicin affects the expression of Cytochrome c (CYCS). [58]
Thalidomide DM70BU5 Approved Thalidomide increases the expression of Cytochrome c (CYCS). [59]
Bexarotene DMOBIKY Approved Bexarotene decreases the expression of Cytochrome c (CYCS). [62]
Hesperetin DMKER83 Approved Hesperetin increases the expression of Cytochrome c (CYCS). [67]
Digitoxin DMWVIGP Approved Digitoxin increases the expression of Cytochrome c (CYCS). [68]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Cytochrome c (CYCS). [75]
Thymoquinone DMVDTR2 Phase 2/3 Thymoquinone increases the expression of Cytochrome c (CYCS). [81]
Delphinidin DMS2WIN Phase 2 Delphinidin increases the expression of Cytochrome c (CYCS). [85]
Torcetrapib DMDHYM7 Discontinued in Phase 2 Torcetrapib increases the expression of Cytochrome c (CYCS). [93]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Cytochrome c (CYCS). [94]
Dioscin DM5H2W9 Preclinical Dioscin increases the expression of Cytochrome c (CYCS). [95]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Cytochrome c (CYCS). [98]
Coumarin DM0N8ZM Investigative Coumarin increases the expression of Cytochrome c (CYCS). [99]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of Cytochrome c (CYCS). [100]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A increases the expression of Cytochrome c (CYCS). [101]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Cytochrome c (CYCS). [102]
GALLICACID DM6Y3A0 Investigative GALLICACID increases the expression of Cytochrome c (CYCS). [103]
D-glucose DMMG2TO Investigative D-glucose increases the expression of Cytochrome c (CYCS). [104]
CH-223191 DMMJZYC Investigative CH-223191 increases the expression of Cytochrome c (CYCS). [51]
(E)-4-(3,5-dimethoxystyryl)phenol DMYXI2V Investigative (E)-4-(3,5-dimethoxystyryl)phenol increases the expression of Cytochrome c (CYCS). [112]
2-tert-butylbenzene-1,4-diol DMNXI1E Investigative 2-tert-butylbenzene-1,4-diol increases the expression of Cytochrome c (CYCS). [51]
Aloe-emodin DMPTY8S Investigative Aloe-emodin increases the expression of Cytochrome c (CYCS). [116]
Hyperforin DM2L3PE Investigative Hyperforin decreases the expression of Cytochrome c (CYCS). [117]
MANGOSTIN DMYQGDV Investigative MANGOSTIN increases the expression of Cytochrome c (CYCS). [118]
DZNep DM0JXBK Investigative DZNep increases the expression of Cytochrome c (CYCS). [119]
ABBV-744 DMTEA9C Investigative ABBV-744 increases the expression of Cytochrome c (CYCS). [120]
ERIODICTYOL DMD3BEQ Investigative ERIODICTYOL increases the expression of Cytochrome c (CYCS). [123]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Cytochrome c (CYCS). [36]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Cytochrome c (CYCS). [89]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Cytochrome c (CYCS). [97]
------------------------------------------------------------------------------------
48 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the localization of Cytochrome c (CYCS). [39]
Bortezomib DMNO38U Approved Bortezomib affects the localization of Cytochrome c (CYCS). [49]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol affects the localization of Cytochrome c (CYCS). [52]
Etoposide DMNH3PG Approved Etoposide affects the localization of Cytochrome c (CYCS). [53]
Nicotine DMWX5CO Approved Nicotine decreases the secretion of Cytochrome c (CYCS). [55]
Indomethacin DMSC4A7 Approved Indomethacin affects the localization of Cytochrome c (CYCS). [56]
Mitomycin DMH0ZJE Approved Mitomycin increases the secretion of Cytochrome c (CYCS). [57]
Sorafenib DMS8IFC Approved Sorafenib affects the localization of Cytochrome c (CYCS). [60]
Gefitinib DM15F0X Approved Gefitinib affects the localization of Cytochrome c (CYCS). [61]
Nitric Oxide DM1RBYG Approved Nitric Oxide decreases the secretion of Cytochrome c (CYCS). [63]
Glucosamine DM4ZLFD Approved Glucosamine affects the localization of Cytochrome c (CYCS). [64]
Morphine DMRMS0L Approved Morphine increases the secretion of Cytochrome c (CYCS). [65]
Eicosapentaenoic acid/docosa-hexaenoic acid DMMUCG4 Approved Eicosapentaenoic acid/docosa-hexaenoic acid affects the localization of Cytochrome c (CYCS). [66]
Methadone DMTW6IU Approved Methadone affects the localization of Cytochrome c (CYCS). [69]
Phosphate DMUXQG7 Approved Phosphate affects the localization of Cytochrome c (CYCS). [70]
Ceritinib DMB920Z Approved Ceritinib affects the localization of Cytochrome c (CYCS). [71]
Leuprorelin acetate DM15HAT Approved Leuprorelin acetate affects the localization of Cytochrome c (CYCS). [72]
Pefloxacin DM49IGF Approved Pefloxacin increases the secretion of Cytochrome c (CYCS). [73]
Berberine DMC5Q8X Phase 4 Berberine affects the localization of Cytochrome c (CYCS). [74]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate affects the localization of Cytochrome c (CYCS). [76]
Curcumin DMQPH29 Phase 3 Curcumin affects the localization of Cytochrome c (CYCS). [77]
Camptothecin DM6CHNJ Phase 3 Camptothecin affects the localization of Cytochrome c (CYCS). [78]
Atorvastatin DMF28YC Phase 3 Trial Atorvastatin affects the localization of Cytochrome c (CYCS). [79]
I3C DMIGFOR Phase 3 I3C affects the localization of Cytochrome c (CYCS). [80]
Genistein DM0JETC Phase 2/3 Genistein affects the localization of Cytochrome c (CYCS). [52]
PEITC DMOMN31 Phase 2 PEITC affects the localization of Cytochrome c (CYCS). [82]
Flavopiridol DMKSUOI Phase 2 Flavopiridol affects the localization of Cytochrome c (CYCS). [83]
URSOLIC ACID DM4SOAW Phase 2 URSOLIC ACID affects the localization of Cytochrome c (CYCS). [84]
R-roscovitine DMSH108 Phase 2 R-roscovitine affects the localization of Cytochrome c (CYCS). [86]
PIPERINE DMYEAB1 Phase 1/2 PIPERINE affects the localization of Cytochrome c (CYCS). [87]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the localization of Cytochrome c (CYCS). [88]
LY294002 DMY1AFS Phase 1 LY294002 affects the localization of Cytochrome c (CYCS). [90]
Adaphostin DM16QSG Phase 1 Adaphostin affects the localization of Cytochrome c (CYCS). [91]
PMID28870136-Compound-49 DMTUC9E Patented PMID28870136-Compound-49 increases the secretion of Cytochrome c (CYCS). [92]
F-12509A DM3786U Terminated F-12509A affects the localization of Cytochrome c (CYCS). [96]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde affects the localization of Cytochrome c (CYCS). [105]
Chlorpyrifos DMKPUI6 Investigative Chlorpyrifos affects the localization of Cytochrome c (CYCS). [106]
acrolein DMAMCSR Investigative acrolein affects the localization of Cytochrome c (CYCS). [107]
Arachidonic acid DMUOQZD Investigative Arachidonic acid affects the localization of Cytochrome c (CYCS). [108]
Rutin DMEHRAJ Investigative Rutin affects the localization of Cytochrome c (CYCS). [109]
Kaempferol DMHEMUB Investigative Kaempferol affects the localization of Cytochrome c (CYCS). [110]
CATECHIN DMY38SB Investigative CATECHIN affects the localization of Cytochrome c (CYCS). [111]
Apigenin DMI3491 Investigative Apigenin affects the localization of Cytochrome c (CYCS). [113]
Myricetin DMTV4L0 Investigative Myricetin affects the localization of Cytochrome c (CYCS). [114]
Apicidin DM83WVF Investigative Apicidin affects the localization of Cytochrome c (CYCS). [115]
Flavanone DMNWIYM Investigative Flavanone affects the localization of Cytochrome c (CYCS). [121]
SNX-2112 DMB5A80 Investigative SNX-2112 affects the localization of Cytochrome c (CYCS). [122]
(5-(1-benzyl-1H-indazol-3-yl)furan-2-yl)methanol DM15P2G Investigative (5-(1-benzyl-1H-indazol-3-yl)furan-2-yl)methanol affects the localization of Cytochrome c (CYCS). [78]
------------------------------------------------------------------------------------
⏷ Show the Full List of 48 Drug(s)

References

1 Human chorionic somatomammotropin enhancer function is mediated by cooperative binding of TEF-1 and CSEF-1 to multiple, low-affinity binding sites.Mol Endocrinol. 1997 Aug;11(9):1223-32. doi: 10.1210/mend.11.9.9984.
2 Retinoic acid worsens ATG10-dependent autophagy impairment in TBK1-mutant hiPSC-derived motoneurons through SQSTM1/p62 accumulation.Autophagy. 2019 Oct;15(10):1719-1737. doi: 10.1080/15548627.2019.1589257. Epub 2019 Apr 2.
3 Long term follow-up of Behet's syndrome patients treated with cyclophosphamide.Rheumatology (Oxford). 2020 Sep 1;59(9):2264-2271. doi: 10.1093/rheumatology/kez598.
4 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.Alzheimers Dement. 2014 Jan;10(1):45-52. doi: 10.1016/j.jalz.2013.01.008. Epub 2013 Mar 25.
5 Pituitary dysfunction in granulomatosis with polyangiitis.Clin Rheumatol. 2020 Feb;39(2):595-606. doi: 10.1007/s10067-019-04735-7. Epub 2019 Aug 24.
6 A novel glucocorticoid-free maintenance regimen for anti-neutrophil cytoplasm antibody-associated vasculitis.Rheumatology (Oxford). 2019 Feb 1;58(2):260-268. doi: 10.1093/rheumatology/key288.
7 Overexpression of copper/zinc superoxide dismutase in transgenic rats protects vulnerable neurons against ischemic damage by blocking the mitochondrial pathway of caspase activation.J Neurosci. 2002 Jan 1;22(1):209-17. doi: 10.1523/JNEUROSCI.22-01-00209.2002.
8 Different transcriptional strategies for ccn2/ctgf gene induction between human chondrocytic and breast cancer cell lines.Biochimie. 2007 Mar;89(3):278-88. doi: 10.1016/j.biochi.2006.12.006. Epub 2007 Jan 3.
9 ADAM8 promotes chondrosarcoma cell migration and invasion by activating the NF-B/MMP-13 signaling axis.Anticancer Drugs. 2019 Aug;30(7):e0790. doi: 10.1097/CAD.0000000000000790.
10 Effects of long-term low oxygen tension in human chondrosarcoma cells.J Cell Biochem. 2018 Feb;119(2):2320-2332. doi: 10.1002/jcb.26394. Epub 2017 Oct 18.
11 Treatment with cyclophosphamide i.v. pulse therapy is an option for effective treatment of skin fibrosis in patients with early systemic sclerosis.Rheumatology (Oxford). 2020 Jul 1;59(7):1550-1555. doi: 10.1093/rheumatology/kez487.
12 Mitochondrial adaptations to obesity-related oxidant stress.Arch Biochem Biophys. 2000 Jun 15;378(2):259-68. doi: 10.1006/abbi.2000.1829.
13 High Content Imaging Assays for IL-6-Induced STAT3 Pathway Activation in Head and Neck Cancer Cell Lines.Methods Mol Biol. 2018;1683:229-244. doi: 10.1007/978-1-4939-7357-6_14.
14 A case report of spontaneous mutation (C33>U) in the iron-responsive element of L-ferritin causing hyperferritinemia-cataract syndrome.Blood Cells Mol Dis. 2010 Jan 15;44(1):22-7. doi: 10.1016/j.bcmd.2009.09.003. Epub 2009 Oct 2.
15 Oral cyclophosphamide in treatment of patients with refractory idiopathic inflammatory myopathies: a retrospective observational study.Clin Rheumatol. 2018 Aug;37(8):2113-2123. doi: 10.1007/s10067-018-4174-3. Epub 2018 Jul 3.
16 Platelets from a patient heterozygous for the defect of P2CYC receptors for ADP have a secretion defect despite normal thromboxane A2 production and normal granule stores: further evidence that some cases of platelet 'primary secretion defect' are heterozygous for a defect of P2CYC receptors.Arterioscler Thromb Vasc Biol. 2000 Nov;20(11):E101-6. doi: 10.1161/01.atv.20.11.e101.
17 The Chinese herb Tripterygium wilfordii Hook F for the treatment of systemic sclerosis-associated interstitial lung disease: data from a Chinese EUSTAR Center.Clin Rheumatol. 2020 Mar;39(3):813-821. doi: 10.1007/s10067-019-04784-y. Epub 2019 Nov 12.
18 Alcohol increases tumor necrosis factor alpha and decreases nuclear factor-kappab to activate hepatic apoptosis in genetically obese mice.Hepatology. 2005 Dec;42(6):1280-90. doi: 10.1002/hep.20949.
19 Autophagy in Xenopus laevis rod photoreceptors is independently regulated by phototransduction and misfolded RHO(P23H).Autophagy. 2019 Nov;15(11):1970-1989. doi: 10.1080/15548627.2019.1596487. Epub 2019 Apr 12.
20 Association between immunosuppressive therapy and course of mild interstitial lung disease in systemic sclerosis.Rheumatology (Oxford). 2020 May 1;59(5):1108-1117. doi: 10.1093/rheumatology/kez407.
21 Brief Report: The Euro-Lupus Low-Dose Intravenous Cyclophosphamide Regimen Does Not Impact the Ovarian Reserve, as Measured by Serum Levels of Anti-Mllerian Hormone.Arthritis Rheumatol. 2017 Jun;69(6):1267-1271. doi: 10.1002/art.40079. Epub 2017 May 3.
22 Diagnostic high-throughput sequencing of 2396 patients with bleeding, thrombotic, and platelet disorders.Blood. 2019 Dec 5;134(23):2082-2091. doi: 10.1182/blood.2018891192.
23 A mutation of human cytochrome c enhances the intrinsic apoptotic pathway but causes only thrombocytopenia. Nat Genet. 2008 Apr;40(4):387-9. doi: 10.1038/ng.103. Epub 2008 Mar 16.
24 Further delineation of genotype-phenotype correlation in homozygous 2p21 deletion syndromes: first description of patients without cystinuria.Am J Med Genet A. 2013 Aug;161A(8):1853-9. doi: 10.1002/ajmg.a.35994. Epub 2013 Jun 21.
25 Minocycline inhibits apoptosis and inflammation in a rat model of ischemic renal injury.Am J Physiol Renal Physiol. 2004 Oct;287(4):F760-6. doi: 10.1152/ajprenal.00050.2004. Epub 2004 Jun 1.
26 Combined immunosuppressive treatment (CIST) in lupus nephritis: a multicenter, randomized controlled study.Clin Rheumatol. 2019 Apr;38(4):1047-1054. doi: 10.1007/s10067-018-4368-8. Epub 2018 Nov 28.
27 Quantitative analysis of mitochondrial protein expression in methylmalonic acidemia by two-dimensional difference gel electrophoresis.J Proteome Res. 2006 Jul;5(7):1602-10. doi: 10.1021/pr050481r.
28 Effectiveness of etanercept vs cyclophosphamide as treatment for patients with amyloid A amyloidosis secondary to rheumatoid arthritis.Rheumatology (Oxford). 2012 Nov;51(11):2064-9. doi: 10.1093/rheumatology/kes190. Epub 2012 Aug 9.
29 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
30 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
31 Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
32 Response rate of fibrosarcoma cells to cytotoxic drugs on the expression level correlates to the therapeutic response rate of fibrosarcomas and is mediated by regulation of apoptotic pathways. BMC Cancer. 2005 Jul 7;5:74. doi: 10.1186/1471-2407-5-74.
33 Systematic transcriptome-based comparison of cellular adaptive stress response activation networks in hepatic stem cell-derived progeny and primary human hepatocytes. Toxicol In Vitro. 2021 Jun;73:105107. doi: 10.1016/j.tiv.2021.105107. Epub 2021 Feb 3.
34 (4-Picolylamino)-17-Estradiol derivative and analogues induce apoptosis with death receptor trail R2/DR5 in MCF-7. Chem Biol Interact. 2023 Jan 5;369:110286. doi: 10.1016/j.cbi.2022.110286. Epub 2022 Nov 29.
35 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
36 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
37 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
38 Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
39 K-RAS transformation in prostate epithelial cell overcomes H2O2-induced apoptosis via upregulation of gamma-glutamyltransferase-2. Toxicol In Vitro. 2012 Apr;26(3):429-34. doi: 10.1016/j.tiv.2012.01.013. Epub 2012 Jan 17.
40 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
41 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
42 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
43 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
44 Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
45 Zoledronic acid-induced oxidative damage and endoplasmic reticulum stress-mediated apoptosis in human embryonic kidney (HEK-293) cells. J Biochem Mol Toxicol. 2022 Aug;36(8):e23083. doi: 10.1002/jbt.23083. Epub 2022 May 19.
46 Regulation of ERRalpha gene expression by estrogen receptor agonists and antagonists in SKBR3 breast cancer cells: differential molecular mechanisms mediated by g protein-coupled receptor GPR30/GPER-1. Mol Endocrinol. 2010 May;24(5):969-80. doi: 10.1210/me.2009-0148. Epub 2010 Mar 8.
47 Niclosamide induces apoptosis in human rheumatoid arthritis fibroblast-like synoviocytes. Int Immunopharmacol. 2016 Feb;31:45-9. doi: 10.1016/j.intimp.2015.11.002. Epub 2015 Dec 17.
48 Cannabidiol Modulates the Immunophenotype and Inhibits the Activation of the Inflammasome in Human Gingival Mesenchymal Stem Cells. Front Physiol. 2016 Nov 24;7:559. doi: 10.3389/fphys.2016.00559. eCollection 2016.
49 Differential regulation of noxa in normal melanocytes and melanoma cells by proteasome inhibition: therapeutic implications. Cancer Res. 2005 Jul 15;65(14):6294-304. doi: 10.1158/0008-5472.CAN-05-0686.
50 Troglitazone induces cytotoxicity in part by promoting the degradation of peroxisome proliferator-activated receptor co-activator-1 protein. Br J Pharmacol. 2010 Oct;161(4):771-81. doi: 10.1111/j.1476-5381.2010.00900.x.
51 Ligand-independent activation of AhR by hydroquinone mediates benzene-induced hematopoietic toxicity. Chem Biol Interact. 2022 Mar 1;355:109845. doi: 10.1016/j.cbi.2022.109845. Epub 2022 Feb 4.
52 Apoptotic and anti-proliferative effects of 17beta-estradiol and 17beta-estradiol-like compounds in the Hep3B cell line. Mol Cell Biochem. 2006 Oct;290(1-2):1-7. doi: 10.1007/s11010-005-9000-y. Epub 2006 Aug 19.
53 Induction of mitochondrial manganese superoxide dismutase confers resistance to apoptosis in acute myeloblastic leukaemia cells exposed to etoposide. Br J Haematol. 2000 Mar;108(3):574-81. doi: 10.1046/j.1365-2141.2000.01852.x.
54 Proteomic analysis of anti-cancer effects by paclitaxel treatment in cervical cancer cells. Gynecol Oncol. 2005 Jul;98(1):45-53. doi: 10.1016/j.ygyno.2005.04.010.
55 Nicotine inhibits UV-induced activation of the apoptotic pathway. Toxicol Lett. 2001 Dec 15;125(1-3):61-5. doi: 10.1016/s0378-4274(01)00416-7.
56 Indomethacin-induced apoptosis in esophageal adenocarcinoma cells involves upregulation of Bax and translocation of mitochondrial cytochrome C independent of COX-2 expression. Neoplasia. 2000 Jul-Aug;2(4):346-56. doi: 10.1038/sj.neo.7900097.
57 Mitomycin C induces apoptosis in a caspases-dependent and Fas/CD95-independent manner in human gastric adenocarcinoma cells. Cancer Lett. 2000 Oct 1;158(2):125-32. doi: 10.1016/s0304-3835(00)00489-4.
58 Identification of the key pathway of oxazolinoanthracyclines mechanism of action in cells derived from human solid tumors. Toxicol Appl Pharmacol. 2016 Dec 15;313:159-169. doi: 10.1016/j.taap.2016.10.018. Epub 2016 Oct 22.
59 Thalidomide inhibits growth of tumors through COX-2 degradation independent of antiangiogenesis. Vascul Pharmacol. 2005 Aug;43(2):112-9. doi: 10.1016/j.vph.2005.04.003.
60 The role of Mcl-1 downregulation in the proapoptotic activity of the multikinase inhibitor BAY 43-9006. Oncogene. 2005 Oct 20;24(46):6861-9. doi: 10.1038/sj.onc.1208841.
61 Evidence of securin-mediated resistance to gefitinib-induced apoptosis in human cancer cells. Chem Biol Interact. 2013 Apr 25;203(2):412-22. doi: 10.1016/j.cbi.2013.03.011. Epub 2013 Mar 22.
62 Identification of biomarkers modulated by the rexinoid LGD1069 (bexarotene) in human breast cells using oligonucleotide arrays. Cancer Res. 2006 Dec 15;66(24):12009-18.
63 Nitric oxide inhibits execution of apoptosis at two distinct ATP-dependent steps upstream and downstream of mitochondrial cytochrome c release. Biochem Biophys Res Commun. 1999 Apr 29;258(1):215-21. doi: 10.1006/bbrc.1999.0491.
64 [Role of Bcl-xL in the cathepsin D-associated apoptosis of K562 cells]. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2005 Jun;13(3):379-82.
65 Chronic high-dose morphine treatment promotes SH-SY5Y cell apoptosis via c-Jun N-terminal kinase-mediated activation of mitochondria-dependent pathway. FEBS J. 2009 Apr;276(7):2022-36. doi: 10.1111/j.1742-4658.2009.06938.x.
66 Docosahexaenoic acid increases the expression of oxidative stress-induced growth inhibitor 1 through the PI3K/Akt/Nrf2 signaling pathway in breast cancer cells. Food Chem Toxicol. 2017 Oct;108(Pt A):276-288. doi: 10.1016/j.fct.2017.08.010. Epub 2017 Aug 12.
67 Role of hesperetin (a natural flavonoid) and its analogue on apoptosis in HT-29 human colon adenocarcinoma cell line--a comparative study. Food Chem Toxicol. 2012 Mar;50(3-4):660-71.
68 Digitoxin and a synthetic monosaccharide analog inhibit cell viability in lung cancer cells. Toxicol Appl Pharmacol. 2012 Jan 1;258(1):51-60. doi: 10.1016/j.taap.2011.10.007. Epub 2011 Oct 18.
69 Methadone induces necrotic-like cell death in SH-SY5Y cells by an impairment of mitochondrial ATP synthesis. Biochim Biophys Acta. 2010 Nov;1802(11):1036-47. doi: 10.1016/j.bbadis.2010.07.024. Epub 2010 Aug 3.
70 High expression of the Pi-transporter SLC20A1/Pit1 in calcific aortic valve disease promotes mineralization through regulation of Akt-1. PLoS One. 2013;8(1):e53393. doi: 10.1371/journal.pone.0053393. Epub 2013 Jan 4.
71 1-(4-((5-chloro-4-((2-(isopropylsulfonyl)phenyl)amino)pyrimidin-2-yl)amino)-3-methoxyphenyl)-3-(2-(dimethylamino)ethyl)imidazolidin-2-one (ZX-42) inhibits cell proliferation and induces apoptosis via inhibiting ALK and its downstream pathways in Karpas299 cells. Toxicol Appl Pharmacol. 2022 Sep 1;450:116156. doi: 10.1016/j.taap.2022.116156. Epub 2022 Jul 6.
72 Effects of gonadotrophin-releasing hormone agonists on apoptosis of granulosa cells. Ann N Y Acad Sci. 2005 May;1042:531-7. doi: 10.1196/annals.1338.065.
73 Under ambient UVA exposure, pefloxacin exhibits both immunomodulatory and genotoxic effects via multiple mechanisms. J Photochem Photobiol B. 2018 Jan;178:593-605. doi: 10.1016/j.jphotobiol.2017.12.014. Epub 2017 Dec 15.
74 Berberine, a natural product, induces G1-phase cell cycle arrest and caspase-3-dependent apoptosis in human prostate carcinoma cells. Mol Cancer Ther. 2006 Feb;5(2):296-308. doi: 10.1158/1535-7163.MCT-05-0448.
75 Effect of resveratrol on mitochondrial function: implications in parkin-associated familiar Parkinson's disease. Biochim Biophys Acta. 2014 Jul;1842(7):902-15.
76 Epigallocatechin-3-gallate induces apoptosis in estrogen receptor-negative human breast carcinoma cells via modulation in protein expression of p53 and Bax and caspase-3 activation. Mol Cancer Ther. 2005 Jan;4(1):81-90.
77 Curcumin induces apoptosis through the mitochondria-mediated apoptotic pathway in HT-29 cells. J Zhejiang Univ Sci B. 2009 Feb;10(2):93-102. doi: 10.1631/jzus.B0820238.
78 Combined application of camptothecin and the guanylate cyclase activator YC-1: Impact on cell death and apoptosis-related proteins in ovarian carcinoma cell lines. Chem Biol Interact. 2009 Oct 7;181(2):185-92. doi: 10.1016/j.cbi.2009.05.013. Epub 2009 May 27.
79 Atorvastatin induces mitochondrial dysfunction and cell apoptosis in HepG2 cells via inhibition of the Nrf2 pathway. J Appl Toxicol. 2019 Oct;39(10):1394-1404. doi: 10.1002/jat.3825. Epub 2019 Aug 18.
80 Molecular targets and anticancer potential of indole-3-carbinol and its derivatives. Cell Cycle. 2005 Sep;4(9):1201-15. doi: 10.4161/cc.4.9.1993. Epub 2005 Sep 6.
81 Thymoquinone induces apoptosis of human epidermoid carcinoma A431?cells through ROS-mediated suppression of STAT3. Chem Biol Interact. 2019 Oct 1;312:108799. doi: 10.1016/j.cbi.2019.108799. Epub 2019 Aug 18.
82 Effects of antioxidants and caspase-3 inhibitor on the phenylethyl isothiocyanate-induced apoptotic signaling pathways in human PLC/PRF/5 cells. Eur J Pharmacol. 2005 Aug 22;518(2-3):96-106. doi: 10.1016/j.ejphar.2005.06.021.
83 Loss of the Bcl-2 phosphorylation loop domain is required to protect human myeloid leukemia cells from flavopiridol-mediated mitochondrial damage and apoptosis. Cancer Biol Ther. 2002 Mar-Apr;1(2):136-44. doi: 10.4161/cbt.58.
84 Molecular mechanism of ursolic acid induced apoptosis in poorly differentiated endometrial cancer HEC108 cells. Oncol Rep. 2005 Aug;14(2):507-12.
85 Delphinidin modulates JAK/STAT3 and MAPKinase signaling to induce apoptosis in HCT116 cells. Environ Toxicol. 2021 Aug;36(8):1557-1566. doi: 10.1002/tox.23152. Epub 2021 May 6.
86 Accumulation of p53 and reductions in XIAP abundance promote the apoptosis of prostate cancer cells. Cancer Res. 2005 Sep 1;65(17):7717-23. doi: 10.1158/0008-5472.CAN-05-0347.
87 Targeting hepatocellular carcinoma with piperine by radical-mediated mitochondrial pathway of apoptosis: an initro and inivo study. Food Chem Toxicol. 2017 Jul;105:106-118.
88 Gaseous nitrogen oxide repressed benzo[a]pyrene-induced human lung fibroblast cell apoptosis via inhibiting JNK1 signals. Arch Toxicol. 2005 Dec;79(12):694-704. doi: 10.1007/s00204-005-0001-0. Epub 2005 Jul 22.
89 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
90 GSK-3beta reactivation with LY294002 sensitizes hepatoma cells to chemotherapy-induced apoptosis. Int J Oncol. 2005 Jul;27(1):215-22.
91 Induction of apoptosis in human leukemia cells by the tyrosine kinase inhibitor adaphostin proceeds through a RAF-1/MEK/ERK- and AKT-dependent process. Oncogene. 2004 Feb 19;23(7):1364-76. doi: 10.1038/sj.onc.1207248.
92 Pentoxifylline induces apoptosis in vitro in cutaneous T cell lymphoma (HuT-78) and enhances FasL mediated killing by upregulating Fas expression. Biochem Pharmacol. 2009 Jan 1;77(1):30-45. doi: 10.1016/j.bcp.2008.09.018. Epub 2008 Sep 21.
93 Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
94 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
95 Dioscin inhibits human endometrial carcinoma proliferation via G0/G1 cell cycle arrest and mitochondrial-dependent signaling pathway. Food Chem Toxicol. 2021 Feb;148:111941. doi: 10.1016/j.fct.2020.111941. Epub 2020 Dec 24.
96 Overcoming MDR-associated chemoresistance in HL-60 acute myeloid leukemia cells by targeting sphingosine kinase-1. Leukemia. 2006 Jan;20(1):95-102. doi: 10.1038/sj.leu.2404023.
97 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
98 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
99 A synthetic coumarin derivative (4-flourophenylacetamide-acetyl coumarin) impedes cell cycle at G0/G1 stage, induces apoptosis, and inhibits metastasis via ROS-mediated p53 and AKT signaling pathways in A549 cells. J Biochem Mol Toxicol. 2020 Oct;34(10):e22553. doi: 10.1002/jbt.22553. Epub 2020 Jun 24.
100 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
101 Central role of TRAP1 in the ameliorative effect of oleanolic acid on the mitochondrial-mediated and endoplasmic reticulum stress-excitated apoptosis induced by ochratoxin A. Toxicology. 2021 Feb 28;450:152681. doi: 10.1016/j.tox.2021.152681. Epub 2021 Jan 16.
102 Recombinant adenovirus Ad-RUNrf2 reduces paraquat-induced A549 injury. Hum Exp Toxicol. 2012 Nov;31(11):1102-12. doi: 10.1177/0960327112450902. Epub 2012 Jun 26.
103 Anti-leukemic effects of gallic acid on human leukemia K562 cells: downregulation of COX-2, inhibition of BCR/ABL kinase and NF-B inactivation. Toxicol In Vitro. 2012 Apr;26(3):396-405.
104 Melatonin prevents blood-retinal barrier breakdown and mitochondrial dysfunction in high glucose and hypoxia-induced in vitro diabetic macular edema model. Toxicol In Vitro. 2021 Sep;75:105191. doi: 10.1016/j.tiv.2021.105191. Epub 2021 May 5.
105 Effects of vitamin E on the cinnamaldehyde-induced apoptotic mechanism in human PLC/PRF/5 cells. Clin Exp Pharmacol Physiol. 2004 Nov;31(11):770-6. doi: 10.1111/j.1440-1681.2004.04091.x.
106 JNK and p38 MAPK regulate oxidative stress and the inflammatory response in chlorpyrifos-induced apoptosis. Toxicol Lett. 2013 Apr 26;218(3):235-45.
107 Acrolein induces a cellular stress response and triggers mitochondrial apoptosis in A549 cells. Chem Biol Interact. 2009 Oct 7;181(2):154-67. doi: 10.1016/j.cbi.2009.07.001. Epub 2009 Jul 9.
108 Arachidonic acid induces Fas and FasL upregulation in human leukemia U937 cells via Ca2+/ROS-mediated suppression of ERK/c-Fos pathway and activation of p38 MAPK/ATF-2 pathway. Toxicol Lett. 2009 Dec 15;191(2-3):140-8. doi: 10.1016/j.toxlet.2009.08.016. Epub 2009 Aug 29.
109 Herbacetin induces apoptosis in HepG2 cells: Involvements of ROS and PI3K/Akt pathway. Food Chem Toxicol. 2013 Jan;51:426-33. doi: 10.1016/j.fct.2012.09.036. Epub 2012 Oct 12.
110 Kaempferol induces apoptosis in human HCT116 colon cancer cells via the Ataxia-Telangiectasia Mutated-p53 pathway with the involvement of p53 Upregulated Modulator of Apoptosis. Chem Biol Interact. 2009 Jan 27;177(2):121-7. doi: 10.1016/j.cbi.2008.10.048. Epub 2008 Nov 5.
111 Role of fatty acid chain length on the induction of apoptosis by newly synthesized catechin derivatives. Chem Biol Interact. 2010 May 14;185(3):182-8. doi: 10.1016/j.cbi.2010.02.045. Epub 2010 Mar 4.
112 ERK5/HDAC5-mediated, resveratrol-, and pterostilbene-induced expression of MnSOD in human endothelial cells. Mol Nutr Food Res. 2016 Feb;60(2):266-77. doi: 10.1002/mnfr.201500466. Epub 2015 Oct 23.
113 Apigenin drives the production of reactive oxygen species and initiates a mitochondrial mediated cell death pathway in prostate epithelial cells. Prostate. 2005 May 1;63(2):131-42. doi: 10.1002/pros.20167.
114 Mitochondrial-dependent, reactive oxygen species-independent apoptosis by myricetin: roles of protein kinase C, cytochrome c, and caspase cascade. Biochem Pharmacol. 2005 Mar 15;69(6):913-27. doi: 10.1016/j.bcp.2004.12.005.
115 Mechanism of apicidin-induced cell cycle arrest and apoptosis in Ishikawa human endometrial cancer cells. Chem Biol Interact. 2009 May 15;179(2-3):169-77. doi: 10.1016/j.cbi.2008.11.011. Epub 2008 Nov 25.
116 The molecular effects of aloe-emodin (AE)/liposome-AE on human nonmelanoma skin cancer cells and skin permeation. Chem Res Toxicol. 2009 Dec;22(12):2017-28. doi: 10.1021/tx900318a.
117 Neuroprotective role of hyperforin on aluminum maltolate-induced oxidative damage and apoptosis in PC12 cells and SH-SY5Y cells. Chem Biol Interact. 2019 Feb 1;299:15-26. doi: 10.1016/j.cbi.2018.11.016. Epub 2018 Nov 24.
118 -Mangostin-induced apoptosis is mediated by estrogen receptor in human breast cancer cells. Food Chem Toxicol. 2014 Apr;66:158-65. doi: 10.1016/j.fct.2014.01.040. Epub 2014 Jan 28.
119 S-adenosylhomocysteine (AdoHcy)-dependent methyltransferase inhibitor DZNep overcomes breast cancer tamoxifen resistance via induction of NSD2 degradation and suppression of NSD2-driven redox homeostasis. Chem Biol Interact. 2020 Feb 1;317:108965. doi: 10.1016/j.cbi.2020.108965. Epub 2020 Jan 28.
120 ABBV-744 induces autophagy in gastric cancer cells by regulating PI3K/AKT/mTOR/p70S6k and MAPK signaling pathways. Neoplasia. 2023 Nov;45:100936. doi: 10.1016/j.neo.2023.100936. Epub 2023 Sep 26.
121 The apoptotic effects of the flavonoid N101-2 in human cervical cancer cells. Toxicol In Vitro. 2012 Feb;26(1):67-73. doi: 10.1016/j.tiv.2011.10.012. Epub 2011 Oct 29.
122 The Hsp90 inhibitor SNX-2112, induces apoptosis in multidrug resistant K562/ADR cells through suppression of Akt/NF-B and disruption of mitochondria-dependent pathways. Chem Biol Interact. 2013 Sep 5;205(1):1-10. doi: 10.1016/j.cbi.2013.06.007. Epub 2013 Jun 15.
123 Eriodictyol regulated ferroptosis, mitochondrial dysfunction, and cell viability via Nrf2/HO-1/NQO1 signaling pathway in ovarian cancer cells. J Biochem Mol Toxicol. 2023 Jul;37(7):e23368. doi: 10.1002/jbt.23368. Epub 2023 Apr 5.