General Information of Drug Off-Target (DOT) (ID: OTHD0XS0)

DOT Name Protein regulator of cytokinesis 1 (PRC1)
Gene Name PRC1
Related Disease
B-cell neoplasm ( )
Neoplasm ( )
Prostate cancer ( )
Prostate carcinoma ( )
Acute myelogenous leukaemia ( )
Adult lymphoma ( )
Advanced cancer ( )
Biliary tract cancer ( )
Breast cancer ( )
Breast neoplasm ( )
Castration-resistant prostate carcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal adenoma ( )
Cytomegalovirus infection ( )
Familial adenomatous polyposis ( )
Glioma ( )
Hepatocellular carcinoma ( )
IgA nephropathy ( )
Lung squamous cell carcinoma ( )
Male infertility ( )
Metastatic prostate carcinoma ( )
Myelodysplastic syndrome ( )
Non-small-cell lung cancer ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Pediatric lymphoma ( )
Plasma cell myeloma ( )
Retinoblastoma ( )
Systemic lupus erythematosus ( )
T-cell lymphoma ( )
Wilson disease ( )
Gastric cancer ( )
Glioblastoma multiforme ( )
Lung adenocarcinoma ( )
Stomach cancer ( )
Urinary bladder cancer ( )
Acute respiratory failure ( )
Breast carcinoma ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Liver cancer ( )
Lymphoma ( )
Non-insulin dependent diabetes ( )
Oral mucosa leukoplakia ( )
Rheumatic fever ( )
UniProt ID
PRC1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3NRX; 3NRY; 4L3I; 4L6Y; 5KMG; 7VBG
Pfam ID
PF03999
Sequence
MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEES
LKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQE
LKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQ
IILCMEALDHTPDTSFERDVVCEDEDAFCLSLENIATLQKLLRQLEMQKSQNEAVCEGLR
TQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVDRLEELKMQNMKKVIEAIRVE
LVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEE
TWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKA
FMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPN
TPGKARKLNTTTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTG
RHGANKENLELNGSILSGGYPGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQREL
SKASKSDATSGILNSTNIQS
Function
Key regulator of cytokinesis that cross-links antiparrallel microtubules at an average distance of 35 nM. Essential for controlling the spatiotemporal formation of the midzone and successful cytokinesis. Required for KIF14 localization to the central spindle and midbody. Required to recruit PLK1 to the spindle. Stimulates PLK1 phosphorylation of RACGAP1 to allow recruitment of ECT2 to the central spindle. Acts as an oncogene for promoting bladder cancer cells proliferation, apoptosis inhibition and carcinogenic progression.
Tissue Specificity Overexpressed in bladder cancer cells .
Reactome Pathway
RHO GTPases activate CIT (R-HSA-5625900 )

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
B-cell neoplasm DISVY326 Definitive Biomarker [1]
Neoplasm DISZKGEW Definitive Biomarker [2]
Prostate cancer DISF190Y Definitive Altered Expression [3]
Prostate carcinoma DISMJPLE Definitive Altered Expression [3]
Acute myelogenous leukaemia DISCSPTN Strong Biomarker [4]
Adult lymphoma DISK8IZR Strong Biomarker [5]
Advanced cancer DISAT1Z9 Strong Biomarker [6]
Biliary tract cancer DISBNYQL Strong Altered Expression [7]
Breast cancer DIS7DPX1 Strong Altered Expression [8]
Breast neoplasm DISNGJLM Strong Biomarker [9]
Castration-resistant prostate carcinoma DISVGAE6 Strong Biomarker [10]
Colon cancer DISVC52G Strong Posttranslational Modification [11]
Colon carcinoma DISJYKUO Strong Posttranslational Modification [11]
Colorectal adenoma DISTSVHM Strong Biomarker [12]
Cytomegalovirus infection DISCEMGC Strong Biomarker [5]
Familial adenomatous polyposis DISW53RE Strong Biomarker [13]
Glioma DIS5RPEH Strong Altered Expression [14]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [15]
IgA nephropathy DISZ8MTK Strong Biomarker [16]
Lung squamous cell carcinoma DISXPIBD Strong Altered Expression [17]
Male infertility DISY3YZZ Strong Altered Expression [18]
Metastatic prostate carcinoma DISVBEZ9 Strong Biomarker [19]
Myelodysplastic syndrome DISYHNUI Strong Biomarker [20]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [21]
Ovarian cancer DISZJHAP Strong Biomarker [22]
Ovarian neoplasm DISEAFTY Strong Biomarker [22]
Pediatric lymphoma DIS51BK2 Strong Biomarker [5]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [23]
Retinoblastoma DISVPNPB Strong Altered Expression [24]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [25]
T-cell lymphoma DISSXRTQ Strong Biomarker [26]
Wilson disease DISVS9H7 Strong Biomarker [27]
Gastric cancer DISXGOUK moderate Altered Expression [28]
Glioblastoma multiforme DISK8246 moderate Biomarker [29]
Lung adenocarcinoma DISD51WR moderate Biomarker [30]
Stomach cancer DISKIJSX moderate Biomarker [28]
Urinary bladder cancer DISDV4T7 moderate Altered Expression [31]
Acute respiratory failure DIS5KQ5Y Limited Biomarker [32]
Breast carcinoma DIS2UE88 Limited Altered Expression [8]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W Limited Biomarker [33]
Liver cancer DISDE4BI Limited Biomarker [33]
Lymphoma DISN6V4S Limited Biomarker [5]
Non-insulin dependent diabetes DISK1O5Z Limited Genetic Variation [34]
Oral mucosa leukoplakia DISJTL5X Limited Biomarker [35]
Rheumatic fever DISLUF66 Limited Biomarker [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 45 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Vinblastine DM5TVS3 Approved Protein regulator of cytokinesis 1 (PRC1) affects the response to substance of Vinblastine. [67]
------------------------------------------------------------------------------------
44 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Protein regulator of cytokinesis 1 (PRC1). [36]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [37]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [38]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Protein regulator of cytokinesis 1 (PRC1). [39]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [40]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [41]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [42]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [43]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Protein regulator of cytokinesis 1 (PRC1). [44]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [45]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [45]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [46]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [47]
Progesterone DMUY35B Approved Progesterone decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [48]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [46]
Fulvestrant DM0YZC6 Approved Fulvestrant decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [42]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [49]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [50]
Cytarabine DMZD5QR Approved Cytarabine decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [46]
Etoposide DMNH3PG Approved Etoposide decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [46]
Paclitaxel DMLB81S Approved Paclitaxel increases the expression of Protein regulator of cytokinesis 1 (PRC1). [46]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [51]
Dasatinib DMJV2EK Approved Dasatinib decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [52]
DTI-015 DMXZRW0 Approved DTI-015 decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [46]
Cidofovir DMA13GD Approved Cidofovir increases the expression of Protein regulator of cytokinesis 1 (PRC1). [53]
Ifosfamide DMCT3I8 Approved Ifosfamide increases the expression of Protein regulator of cytokinesis 1 (PRC1). [53]
Clodronate DM9Y6X7 Approved Clodronate increases the expression of Protein regulator of cytokinesis 1 (PRC1). [53]
Lucanthone DMZLBUO Approved Lucanthone decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [54]
Daunorubicin DMQUSBT Approved Daunorubicin decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [46]
Palbociclib DMD7L94 Approved Palbociclib decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [55]
Bicalutamide DMZMSPF Approved Bicalutamide decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [56]
Hydroxyurea DMOQVU9 Approved Hydroxyurea decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [46]
Adefovir dipivoxil DMMAWY1 Approved Adefovir dipivoxil increases the expression of Protein regulator of cytokinesis 1 (PRC1). [53]
Amsacrine DMZKYIV Approved Amsacrine decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [46]
Isoflavone DM7U58J Phase 4 Isoflavone decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [57]
Camptothecin DM6CHNJ Phase 3 Camptothecin decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [46]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Protein regulator of cytokinesis 1 (PRC1). [58]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [59]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [60]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [61]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [62]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Protein regulator of cytokinesis 1 (PRC1). [63]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [64]
geraniol DMS3CBD Investigative geraniol decreases the expression of Protein regulator of cytokinesis 1 (PRC1). [66]
------------------------------------------------------------------------------------
⏷ Show the Full List of 44 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Protein regulator of cytokinesis 1 (PRC1). [65]
------------------------------------------------------------------------------------

References

1 Site-specific expression of polycomb-group genes encoding the HPC-HPH/PRC1 complex in clinically defined primary nodal and cutaneous large B-cell lymphomas.Am J Pathol. 2004 Feb;164(2):533-42. doi: 10.1016/S0002-9440(10)63143-4.
2 ZWINT is the next potential target for lung cancer therapy.J Cancer Res Clin Oncol. 2019 Mar;145(3):661-673. doi: 10.1007/s00432-018-2823-1. Epub 2019 Jan 14.
3 Protein regulator of cytokinesis 1 overexpression predicts biochemical recurrence in men with prostate cancer.Biomed Pharmacother. 2016 Mar;78:116-120. doi: 10.1016/j.biopha.2016.01.004. Epub 2016 Jan 24.
4 Ezh2 loss promotes development of myelodysplastic syndrome but attenuates its predisposition to leukaemic transformation.Nat Commun. 2014 Jun 23;5:4177. doi: 10.1038/ncomms5177.
5 A Noncanonical Function of Polycomb Repressive Complexes Promotes Human Cytomegalovirus Lytic DNA Replication and Serves as a Novel Cellular Target for Antiviral Intervention.J Virol. 2019 Apr 17;93(9):e02143-18. doi: 10.1128/JVI.02143-18. Print 2019 May 1.
6 Phosphoregulation of the oncogenic protein regulator of cytokinesis 1 (PRC1) by the atypical CDK16/CCNY complex.Exp Mol Med. 2019 Apr 16;51(4):1-17. doi: 10.1038/s12276-019-0242-2.
7 The BMI1 inhibitor PTC-209 is a potential compound to halt cellular growth in biliary tract cancer cells.Oncotarget. 2016 Jan 5;7(1):745-58. doi: 10.18632/oncotarget.6378.
8 Polycomb complexes associate with enhancers and promote oncogenic transcriptional programs in cancer through multiple mechanisms.Nat Commun. 2018 Aug 23;9(1):3377. doi: 10.1038/s41467-018-05728-x.
9 Genome-wide association analysis in East Asians identifies breast cancer susceptibility loci at 1q32.1, 5q14.3 and 15q26.1.Nat Genet. 2014 Aug;46(8):886-90. doi: 10.1038/ng.3041. Epub 2014 Jul 20.
10 BMI1 regulates androgen receptor in prostate cancer independently of the polycomb repressive complex 1.Nat Commun. 2018 Feb 5;9(1):500. doi: 10.1038/s41467-018-02863-3.
11 DNMT1 and DNMT3B modulate distinct polycomb-mediated histone modifications in colon cancer.Cancer Res. 2009 Sep 15;69(18):7412-21. doi: 10.1158/0008-5472.CAN-09-0116. Epub 2009 Sep 1.
12 Effects of polymorphisms in ERCC1, ASE-1 and RAI on the risk of colorectal carcinomas and adenomas: a case control study.BMC Cancer. 2006 Jul 3;6:175. doi: 10.1186/1471-2407-6-175.
13 The microtubule-associated protein PRC1 promotes early recurrence of hepatocellular carcinoma in association with the Wnt/-catenin signalling pathway.Gut. 2016 Sep;65(9):1522-34. doi: 10.1136/gutjnl-2015-310625. Epub 2016 Mar 3.
14 NSPc1 polycomb protein complex binds and crosstalks to lncRNAs in glioma H4 cells.Oncol Rep. 2019 Apr;41(4):2575-2584. doi: 10.3892/or.2019.7000. Epub 2019 Feb 5.
15 MicroRNA-194 inhibits cell invasion and migration in hepatocellular carcinoma through PRC1-mediated inhibition of Wnt/-catenin signaling pathway.Dig Liver Dis. 2019 Sep;51(9):1314-1322. doi: 10.1016/j.dld.2019.02.012. Epub 2019 Mar 1.
16 The molecular phenotype of endocapillary proliferation: novel therapeutic targets for IgA nephropathy.PLoS One. 2014 Aug 18;9(8):e103413. doi: 10.1371/journal.pone.0103413. eCollection 2014.
17 Protein regulator of cytokinesis-1 expression: prognostic value in lung squamous cell carcinoma patients.J Thorac Dis. 2017 Jul;9(7):2054-2060. doi: 10.21037/jtd.2017.06.91.
18 Polycomb directs timely activation of germline genes in spermatogenesis.Genes Dev. 2017 Aug 15;31(16):1693-1703. doi: 10.1101/gad.302000.117. Epub 2017 Sep 18.
19 A Positive Step toward Understanding Double-Negative Metastatic Prostate Cancer.Cancer Cell. 2019 Aug 12;36(2):117-119. doi: 10.1016/j.ccell.2019.07.006.
20 Polycomb protein RING1A limits hematopoietic differentiation in myelodysplastic syndromes.Oncotarget. 2017 Dec 1;8(70):115002-115017. doi: 10.18632/oncotarget.22839. eCollection 2017 Dec 29.
21 Fluorescence imaging of biochemical relationship between ubiquitinated histone 2A and Polycomb complex protein BMI1.Biophys Chem. 2019 Oct;253:106225. doi: 10.1016/j.bpc.2019.106225. Epub 2019 Jul 11.
22 A transcriptome-wide association study of high-grade serous epithelial ovarian cancer identifies new susceptibility genes and splice variants.Nat Genet. 2019 May;51(5):815-823. doi: 10.1038/s41588-019-0395-x. Epub 2019 May 1.
23 The polycomb group protein BMI-1 inhibitor PTC-209 is a potent anti-myeloma agent alone or in combination with epigenetic inhibitors targeting EZH2 and the BET bromodomains.Oncotarget. 2017 Oct 20;8(61):103731-103743. doi: 10.18632/oncotarget.21909. eCollection 2017 Nov 28.
24 PRC1 gene silencing inhibits proliferation, invasion, and angiogenesis of retinoblastoma cells through the inhibition of the Wnt/-catenin signaling pathway.J Cell Biochem. 2019 Oct;120(10):16840-16852. doi: 10.1002/jcb.28942. Epub 2019 May 29.
25 ASE-1: an autoantigen in systemic lupus erythematosus.Lupus. 2000;9(9):681-7. doi: 10.1191/096120300670803230.
26 Association of the long non-coding RNA MALAT1 with the polycomb repressive complex pathway in T and NK cell lymphoma.Oncotarget. 2017 May 9;8(19):31305-31317. doi: 10.18632/oncotarget.15453.
27 Epigenomic signatures in liver and blood of Wilson disease patients include hypermethylation of liver-specific enhancers.Epigenetics Chromatin. 2019 Feb 1;12(1):10. doi: 10.1186/s13072-019-0255-z.
28 Elevated PRC1 in gastric carcinoma exerts oncogenic function and is targeted by piperlongumine in a p53-dependent manner.J Cell Mol Med. 2017 Jul;21(7):1329-1341. doi: 10.1111/jcmm.13063. Epub 2017 Feb 12.
29 Cbx7 is epigenetically silenced in glioblastoma and inhibits cell migration by targeting YAP/TAZ-dependent transcription.Sci Rep. 2016 Jun 13;6:27753. doi: 10.1038/srep27753.
30 MiR-1-3p Inhibits Lung Adenocarcinoma Cell Tumorigenesis via Targeting Protein Regulator of Cytokinesis 1.Front Oncol. 2019 Mar 1;9:120. doi: 10.3389/fonc.2019.00120. eCollection 2019.
31 Oncogenic role of MPHOSPH1, a cancer-testis antigen specific to human bladder cancer.Cancer Res. 2007 Apr 1;67(7):3276-85. doi: 10.1158/0008-5472.CAN-06-3748.
32 Role of the chromobox protein CBX7 in lymphomagenesis.Proc Natl Acad Sci U S A. 2007 Mar 27;104(13):5389-94. doi: 10.1073/pnas.0608721104. Epub 2007 Mar 20.
33 Chitosan-coated doxorubicin nano-particles drug delivery system inhibits cell growth of liver cancer via p53/PRC1 pathway.Biochem Biophys Res Commun. 2018 Jan 1;495(1):414-420. doi: 10.1016/j.bbrc.2017.10.156. Epub 2017 Oct 31.
34 Identification of 28 new susceptibility loci for type 2 diabetes in the Japanese population.Nat Genet. 2019 Mar;51(3):379-386. doi: 10.1038/s41588-018-0332-4. Epub 2019 Feb 4.
35 Regulation of proliferation and cell cycle by protein regulator of cytokinesis 1 in oral squamous cell carcinoma.Cell Death Dis. 2018 May 1;9(5):564. doi: 10.1038/s41419-018-0618-6.
36 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
37 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
38 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
39 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
40 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
41 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
42 Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
43 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
44 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
45 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
46 Characterization of DNA reactive and non-DNA reactive anticancer drugs by gene expression profiling. Mutat Res. 2007 Jun 1;619(1-2):16-29. doi: 10.1016/j.mrfmmm.2006.12.007. Epub 2007 Feb 8.
47 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
48 Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
49 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
50 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
51 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
52 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
53 Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
54 Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
55 Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
56 Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
57 Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
58 Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
59 BET bromodomain inhibition of MYC-amplified medulloblastoma. Clin Cancer Res. 2014 Feb 15;20(4):912-25.
60 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
61 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
62 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
63 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
64 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
65 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
66 Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
67 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.