Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHD0XS0)

• DOT Name: Protein regulator of cytokinesis 1 (PRC1)
• Gene Name: PRC1
• Related Disease:
  B-cell neoplasm
  Neoplasm
  Prostate cancer
  Prostate carcinoma
  Acute myelogenous leukaemia
  Adult lymphoma
  Advanced cancer
  Biliary tract cancer
  Breast cancer
  Breast neoplasm
  Castration-resistant prostate carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal adenoma
  Cytomegalovirus infection
  Familial adenomatous polyposis
  Glioma
  Hepatocellular carcinoma
  IgA nephropathy
  Lung squamous cell carcinoma
  Male infertility
  Metastatic prostate carcinoma
  Myelodysplastic syndrome
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
  Pediatric lymphoma
  Plasma cell myeloma
  Retinoblastoma
  Systemic lupus erythematosus
  T-cell lymphoma
  Wilson disease
  Gastric cancer
  Glioblastoma multiforme
  Lung adenocarcinoma
  Stomach cancer
  Urinary bladder cancer
  Acute respiratory failure
  Breast carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Liver cancer
  Lymphoma
  Non-insulin dependent diabetes
  Oral mucosa leukoplakia
  Rheumatic fever
• UniProt ID: PRC1_HUMAN
• PDB ID: 3NRX; 3NRY; 4L3I; 4L6Y; 5KMG; 7VBG
• Pfam ID: PF03999
• Sequence:
  MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEES
  LKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQE
  LKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQ
  IILCMEALDHTPDTSFERDVVCEDEDAFCLSLENIATLQKLLRQLEMQKSQNEAVCEGLR
  TQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVDRLEELKMQNMKKVIEAIRVE
  LVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEE
  TWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKA
  FMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPN
  TPGKARKLNTTTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTG
  RHGANKENLELNGSILSGGYPGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQREL
  SKASKSDATSGILNSTNIQS
• Function: Key regulator of cytokinesis that cross-links antiparrallel microtubules at an average distance of 35 nM. Essential for controlling the spatiotemporal formation of the midzone and successful cytokinesis. Required for KIF14 localization to the central spindle and midbody. Required to recruit PLK1 to the spindle. Stimulates PLK1 phosphorylation of RACGAP1 to allow recruitment of ECT2 to the central spindle. Acts as an oncogene for promoting bladder cancer cells proliferation, apoptosis inhibition and carcinogenic progression.
• Tissue Specificity: Overexpressed in bladder cancer cells .
• Reactome Pathway: RHO GTPases activate CIT (R-HSA-5625900)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
B-cell neoplasm	DISVY326	Definitive	Biomarker	[1]
Neoplasm	DISZKGEW	Definitive	Biomarker	[2]
Prostate cancer	DISF190Y	Definitive	Altered Expression	[3]
Prostate carcinoma	DISMJPLE	Definitive	Altered Expression	[3]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[4]
Adult lymphoma	DISK8IZR	Strong	Biomarker	[5]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[6]
Biliary tract cancer	DISBNYQL	Strong	Altered Expression	[7]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[8]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[9]
Castration-resistant prostate carcinoma	DISVGAE6	Strong	Biomarker	[10]
Colon cancer	DISVC52G	Strong	Posttranslational Modification	[11]
Colon carcinoma	DISJYKUO	Strong	Posttranslational Modification	[11]
Colorectal adenoma	DISTSVHM	Strong	Biomarker	[12]
Cytomegalovirus infection	DISCEMGC	Strong	Biomarker	[5]
Familial adenomatous polyposis	DISW53RE	Strong	Biomarker	[13]
Glioma	DIS5RPEH	Strong	Altered Expression	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[15]
IgA nephropathy	DISZ8MTK	Strong	Biomarker	[16]
Lung squamous cell carcinoma	DISXPIBD	Strong	Altered Expression	[17]
Male infertility	DISY3YZZ	Strong	Altered Expression	[18]
Metastatic prostate carcinoma	DISVBEZ9	Strong	Biomarker	[19]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[20]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[21]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[22]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[22]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[5]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[23]
Retinoblastoma	DISVPNPB	Strong	Altered Expression	[24]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[25]
T-cell lymphoma	DISSXRTQ	Strong	Biomarker	[26]
Wilson disease	DISVS9H7	Strong	Biomarker	[27]
Gastric cancer	DISXGOUK	moderate	Altered Expression	[28]
Glioblastoma multiforme	DISK8246	moderate	Biomarker	[29]
Lung adenocarcinoma	DISD51WR	moderate	Biomarker	[30]
Stomach cancer	DISKIJSX	moderate	Biomarker	[28]
Urinary bladder cancer	DISDV4T7	moderate	Altered Expression	[31]
Acute respiratory failure	DIS5KQ5Y	Limited	Biomarker	[32]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[8]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Biomarker	[33]
Liver cancer	DISDE4BI	Limited	Biomarker	[33]
Lymphoma	DISN6V4S	Limited	Biomarker	[5]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[34]
Oral mucosa leukoplakia	DISJTL5X	Limited	Biomarker	[35]
Rheumatic fever	DISLUF66	Limited	Biomarker	[32]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Vinblastine	DM5TVS3	Approved	Protein regulator of cytokinesis 1 (PRC1) affects the response to substance of Vinblastine.	[67]

44 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Protein regulator of cytokinesis 1 (PRC1).	[36]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[37]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[38]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein regulator of cytokinesis 1 (PRC1).	[39]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[40]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[41]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[42]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[43]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Protein regulator of cytokinesis 1 (PRC1).	[44]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[45]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[45]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[46]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[47]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[48]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[46]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[42]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[49]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[50]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[46]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[46]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Protein regulator of cytokinesis 1 (PRC1).	[46]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[51]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[52]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[46]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Protein regulator of cytokinesis 1 (PRC1).	[53]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Protein regulator of cytokinesis 1 (PRC1).	[53]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Protein regulator of cytokinesis 1 (PRC1).	[53]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[54]
Daunorubicin	DMQUSBT	Approved	Daunorubicin decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[46]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[55]
Bicalutamide	DMZMSPF	Approved	Bicalutamide decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[56]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[46]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil increases the expression of Protein regulator of cytokinesis 1 (PRC1).	[53]
Amsacrine	DMZKYIV	Approved	Amsacrine decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[46]
Isoflavone	DM7U58J	Phase 4	Isoflavone decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[57]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[46]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Protein regulator of cytokinesis 1 (PRC1).	[58]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[59]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[60]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[61]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[62]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Protein regulator of cytokinesis 1 (PRC1).	[63]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[64]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Protein regulator of cytokinesis 1 (PRC1).	[66]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Protein regulator of cytokinesis 1 (PRC1).	[65]

References

• [1] Site-specific expression of polycomb-group genes encoding the HPC-HPH/PRC1 complex in clinically defined primary nodal and cutaneous large B-cell lymphomas.Am J Pathol. 2004 Feb;164(2):533-42. doi: 10.1016/S0002-9440(10)63143-4.
• [2] ZWINT is the next potential target for lung cancer therapy.J Cancer Res Clin Oncol. 2019 Mar;145(3):661-673. doi: 10.1007/s00432-018-2823-1. Epub 2019 Jan 14.
• [3] Protein regulator of cytokinesis 1 overexpression predicts biochemical recurrence in men with prostate cancer.Biomed Pharmacother. 2016 Mar;78:116-120. doi: 10.1016/j.biopha.2016.01.004. Epub 2016 Jan 24.
• [4] Ezh2 loss promotes development of myelodysplastic syndrome but attenuates its predisposition to leukaemic transformation.Nat Commun. 2014 Jun 23;5:4177. doi: 10.1038/ncomms5177.
• [5] A Noncanonical Function of Polycomb Repressive Complexes Promotes Human Cytomegalovirus Lytic DNA Replication and Serves as a Novel Cellular Target for Antiviral Intervention.J Virol. 2019 Apr 17;93(9):e02143-18. doi: 10.1128/JVI.02143-18. Print 2019 May 1.
• [6] Phosphoregulation of the oncogenic protein regulator of cytokinesis 1 (PRC1) by the atypical CDK16/CCNY complex.Exp Mol Med. 2019 Apr 16;51(4):1-17. doi: 10.1038/s12276-019-0242-2.
• [7] The BMI1 inhibitor PTC-209 is a potential compound to halt cellular growth in biliary tract cancer cells.Oncotarget. 2016 Jan 5;7(1):745-58. doi: 10.18632/oncotarget.6378.
• [8] Polycomb complexes associate with enhancers and promote oncogenic transcriptional programs in cancer through multiple mechanisms.Nat Commun. 2018 Aug 23;9(1):3377. doi: 10.1038/s41467-018-05728-x.
• [9] Genome-wide association analysis in East Asians identifies breast cancer susceptibility loci at 1q32.1, 5q14.3 and 15q26.1.Nat Genet. 2014 Aug;46(8):886-90. doi: 10.1038/ng.3041. Epub 2014 Jul 20.
• [10] BMI1 regulates androgen receptor in prostate cancer independently of the polycomb repressive complex 1.Nat Commun. 2018 Feb 5;9(1):500. doi: 10.1038/s41467-018-02863-3.
• [11] DNMT1 and DNMT3B modulate distinct polycomb-mediated histone modifications in colon cancer.Cancer Res. 2009 Sep 15;69(18):7412-21. doi: 10.1158/0008-5472.CAN-09-0116. Epub 2009 Sep 1.
• [12] Effects of polymorphisms in ERCC1, ASE-1 and RAI on the risk of colorectal carcinomas and adenomas: a case control study.BMC Cancer. 2006 Jul 3;6:175. doi: 10.1186/1471-2407-6-175.
• [13] The microtubule-associated protein PRC1 promotes early recurrence of hepatocellular carcinoma in association with the Wnt/-catenin signalling pathway.Gut. 2016 Sep;65(9):1522-34. doi: 10.1136/gutjnl-2015-310625. Epub 2016 Mar 3.
• [14] NSPc1 polycomb protein complex binds and crosstalks to lncRNAs in glioma H4 cells.Oncol Rep. 2019 Apr;41(4):2575-2584. doi: 10.3892/or.2019.7000. Epub 2019 Feb 5.
• [15] MicroRNA-194 inhibits cell invasion and migration in hepatocellular carcinoma through PRC1-mediated inhibition of Wnt/-catenin signaling pathway.Dig Liver Dis. 2019 Sep;51(9):1314-1322. doi: 10.1016/j.dld.2019.02.012. Epub 2019 Mar 1.
• [16] The molecular phenotype of endocapillary proliferation: novel therapeutic targets for IgA nephropathy.PLoS One. 2014 Aug 18;9(8):e103413. doi: 10.1371/journal.pone.0103413. eCollection 2014.
• [17] Protein regulator of cytokinesis-1 expression: prognostic value in lung squamous cell carcinoma patients.J Thorac Dis. 2017 Jul;9(7):2054-2060. doi: 10.21037/jtd.2017.06.91.
• [18] Polycomb directs timely activation of germline genes in spermatogenesis.Genes Dev. 2017 Aug 15;31(16):1693-1703. doi: 10.1101/gad.302000.117. Epub 2017 Sep 18.
• [19] A Positive Step toward Understanding Double-Negative Metastatic Prostate Cancer.Cancer Cell. 2019 Aug 12;36(2):117-119. doi: 10.1016/j.ccell.2019.07.006.
• [20] Polycomb protein RING1A limits hematopoietic differentiation in myelodysplastic syndromes.Oncotarget. 2017 Dec 1;8(70):115002-115017. doi: 10.18632/oncotarget.22839. eCollection 2017 Dec 29.
• [21] Fluorescence imaging of biochemical relationship between ubiquitinated histone 2A and Polycomb complex protein BMI1.Biophys Chem. 2019 Oct;253:106225. doi: 10.1016/j.bpc.2019.106225. Epub 2019 Jul 11.
• [22] A transcriptome-wide association study of high-grade serous epithelial ovarian cancer identifies new susceptibility genes and splice variants.Nat Genet. 2019 May;51(5):815-823. doi: 10.1038/s41588-019-0395-x. Epub 2019 May 1.
• [23] The polycomb group protein BMI-1 inhibitor PTC-209 is a potent anti-myeloma agent alone or in combination with epigenetic inhibitors targeting EZH2 and the BET bromodomains.Oncotarget. 2017 Oct 20;8(61):103731-103743. doi: 10.18632/oncotarget.21909. eCollection 2017 Nov 28.
• [24] PRC1 gene silencing inhibits proliferation, invasion, and angiogenesis of retinoblastoma cells through the inhibition of the Wnt/-catenin signaling pathway.J Cell Biochem. 2019 Oct;120(10):16840-16852. doi: 10.1002/jcb.28942. Epub 2019 May 29.
• [25] ASE-1: an autoantigen in systemic lupus erythematosus.Lupus. 2000;9(9):681-7. doi: 10.1191/096120300670803230.
• [26] Association of the long non-coding RNA MALAT1 with the polycomb repressive complex pathway in T and NK cell lymphoma.Oncotarget. 2017 May 9;8(19):31305-31317. doi: 10.18632/oncotarget.15453.
• [27] Epigenomic signatures in liver and blood of Wilson disease patients include hypermethylation of liver-specific enhancers.Epigenetics Chromatin. 2019 Feb 1;12(1):10. doi: 10.1186/s13072-019-0255-z.
• [28] Elevated PRC1 in gastric carcinoma exerts oncogenic function and is targeted by piperlongumine in a p53-dependent manner.J Cell Mol Med. 2017 Jul;21(7):1329-1341. doi: 10.1111/jcmm.13063. Epub 2017 Feb 12.
• [29] Cbx7 is epigenetically silenced in glioblastoma and inhibits cell migration by targeting YAP/TAZ-dependent transcription.Sci Rep. 2016 Jun 13;6:27753. doi: 10.1038/srep27753.
• [30] MiR-1-3p Inhibits Lung Adenocarcinoma Cell Tumorigenesis via Targeting Protein Regulator of Cytokinesis 1.Front Oncol. 2019 Mar 1;9:120. doi: 10.3389/fonc.2019.00120. eCollection 2019.
• [31] Oncogenic role of MPHOSPH1, a cancer-testis antigen specific to human bladder cancer.Cancer Res. 2007 Apr 1;67(7):3276-85. doi: 10.1158/0008-5472.CAN-06-3748.
• [32] Role of the chromobox protein CBX7 in lymphomagenesis.Proc Natl Acad Sci U S A. 2007 Mar 27;104(13):5389-94. doi: 10.1073/pnas.0608721104. Epub 2007 Mar 20.
• [33] Chitosan-coated doxorubicin nano-particles drug delivery system inhibits cell growth of liver cancer via p53/PRC1 pathway.Biochem Biophys Res Commun. 2018 Jan 1;495(1):414-420. doi: 10.1016/j.bbrc.2017.10.156. Epub 2017 Oct 31.
• [34] Identification of 28 new susceptibility loci for type 2 diabetes in the Japanese population.Nat Genet. 2019 Mar;51(3):379-386. doi: 10.1038/s41588-018-0332-4. Epub 2019 Feb 4.
• [35] Regulation of proliferation and cell cycle by protein regulator of cytokinesis 1 in oral squamous cell carcinoma.Cell Death Dis. 2018 May 1;9(5):564. doi: 10.1038/s41419-018-0618-6.
• [36] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [37] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [38] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [39] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [40] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [41] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [42] Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
• [43] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [44] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [45] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [46] Characterization of DNA reactive and non-DNA reactive anticancer drugs by gene expression profiling. Mutat Res. 2007 Jun 1;619(1-2):16-29. doi: 10.1016/j.mrfmmm.2006.12.007. Epub 2007 Feb 8.
• [47] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [48] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [49] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [50] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [51] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [52] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [53] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [54] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [55] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [56] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [57] Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
• [58] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [59] BET bromodomain inhibition of MYC-amplified medulloblastoma. Clin Cancer Res. 2014 Feb 15;20(4):912-25.
• [60] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [61] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [62] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [63] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [64] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [65] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [66] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [67] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.