Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTII38K2)

• DOT Name: Cyclin-G2 (CCNG2)
• Gene Name: CCNG2
• Related Disease:
  Adult glioblastoma
  Advanced cancer
  Astrocytoma
  Carcinoma of esophagus
  Colorectal carcinoma
  Diabetic kidney disease
  Epithelial ovarian cancer
  Esophageal cancer
  Gastric adenocarcinoma
  Glioblastoma multiforme
  Glioma
  Glomerulosclerosis
  Hyperinsulinemia
  Kidney cancer
  Neoplasm of esophagus
  Oral cancer
  Ovarian neoplasm
  Renal carcinoma
  Renal cell carcinoma
  Rheumatoid arthritis
  Squamous cell carcinoma
  Triple negative breast cancer
  Carcinoma
  Laryngeal squamous cell carcinoma
  leukaemia
  Leukemia
  Nasopharyngeal carcinoma
  Neuroblastoma
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid tumor
  Breast cancer
  Breast carcinoma
  Gastric cancer
  Gastric neoplasm
  Lung cancer
  Lung carcinoma
  Stomach cancer
• UniProt ID: CCNG2_HUMAN
• Pfam ID: PF00134
• Sequence:
  MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNTLCPGLRNAKV
  EDLRSLANFFGSCTETFVLAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIP
  STHDVIRISQCKCTASDIKRMEKIISEKLHYELEATTALNFLHLYHTIILCHTSERKEIL
  SLDKLEAQLKACNCRLIFSKAKPSVLALCLLNLEVETLKSVELLEILLLVKKHSKINDTE
  FFYWRELVSKCLAEYSSPECCKPDLKKLVWIVSRRTAQNLHNSYYSVPELPTIPEGGCFD
  ESESEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS
• Function: May play a role in growth regulation and in negative regulation of cell cycle progression.
• Tissue Specificity: High levels in cerebellum, thymus, spleen and prostate. Low levels in skeletal muscle.
• KEGG Pathway:
  FoxO sig.ling pathway (hsa04068)
  p53 sig.ling pathway (hsa04115)
• Reactome Pathway: FOXO-mediated transcription of cell cycle genes (R-HSA-9617828)

Molecular Interaction Atlas (MIA) of This DOT

38 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Astrocytoma	DISL3V18	Strong	Altered Expression	[3]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[4]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[5]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[6]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[7]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[4]
Gastric adenocarcinoma	DISWWLTC	Strong	Biomarker	[8]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[1]
Glioma	DIS5RPEH	Strong	Biomarker	[9]
Glomerulosclerosis	DISJF20Z	Strong	Biomarker	[6]
Hyperinsulinemia	DISIDWT6	Strong	Altered Expression	[10]
Kidney cancer	DISBIPKM	Strong	Biomarker	[11]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[4]
Oral cancer	DISLD42D	Strong	Biomarker	[12]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[13]
Renal carcinoma	DISER9XT	Strong	Biomarker	[11]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[11]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[14]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[15]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[16]
Carcinoma	DISH9F1N	moderate	Biomarker	[17]
Laryngeal squamous cell carcinoma	DIS9UUVF	moderate	Altered Expression	[18]
leukaemia	DISS7D1V	moderate	Altered Expression	[19]
Leukemia	DISNAKFL	moderate	Altered Expression	[19]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Altered Expression	[20]
Neuroblastoma	DISVZBI4	moderate	Altered Expression	[21]
Thyroid cancer	DIS3VLDH	moderate	Biomarker	[22]
Thyroid gland carcinoma	DISMNGZ0	moderate	Biomarker	[22]
Thyroid tumor	DISLVKMD	moderate	Biomarker	[22]
Breast cancer	DIS7DPX1	Limited	Biomarker	[23]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[23]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[24]
Gastric neoplasm	DISOKN4Y	Limited	Biomarker	[24]
Lung cancer	DISCM4YA	Limited	Biomarker	[25]
Lung carcinoma	DISTR26C	Limited	Biomarker	[25]
Stomach cancer	DISKIJSX	Limited	Altered Expression	[24]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Topotecan	DMP6G8T	Approved	Cyclin-G2 (CCNG2) affects the response to substance of Topotecan.	[61]

54 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Cyclin-G2 (CCNG2).	[26]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cyclin-G2 (CCNG2).	[27]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Cyclin-G2 (CCNG2).	[28]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Cyclin-G2 (CCNG2).	[29]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Cyclin-G2 (CCNG2).	[30]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Cyclin-G2 (CCNG2).	[31]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Cyclin-G2 (CCNG2).	[32]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Cyclin-G2 (CCNG2).	[33]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Cyclin-G2 (CCNG2).	[34]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Cyclin-G2 (CCNG2).	[35]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Cyclin-G2 (CCNG2).	[36]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Cyclin-G2 (CCNG2).	[37]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of Cyclin-G2 (CCNG2).	[30]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Cyclin-G2 (CCNG2).	[38]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Cyclin-G2 (CCNG2).	[39]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Cyclin-G2 (CCNG2).	[40]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Cyclin-G2 (CCNG2).	[41]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Cyclin-G2 (CCNG2).	[42]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Cyclin-G2 (CCNG2).	[43]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Cyclin-G2 (CCNG2).	[44]
Azacitidine	DMTA5OE	Approved	Azacitidine decreases the expression of Cyclin-G2 (CCNG2).	[45]
Cidofovir	DMA13GD	Approved	Cidofovir decreases the expression of Cyclin-G2 (CCNG2).	[29]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Cyclin-G2 (CCNG2).	[46]
Fenofibrate	DMFKXDY	Approved	Fenofibrate decreases the expression of Cyclin-G2 (CCNG2).	[29]
Ifosfamide	DMCT3I8	Approved	Ifosfamide decreases the expression of Cyclin-G2 (CCNG2).	[29]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of Cyclin-G2 (CCNG2).	[29]
Daunorubicin	DMQUSBT	Approved	Daunorubicin increases the expression of Cyclin-G2 (CCNG2).	[41]
Lindane	DMB8CNL	Approved	Lindane increases the expression of Cyclin-G2 (CCNG2).	[47]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of Cyclin-G2 (CCNG2).	[48]
Prednisolone	DMQ8FR2	Approved	Prednisolone increases the expression of Cyclin-G2 (CCNG2).	[47]
Fluoxetine	DM3PD2C	Approved	Fluoxetine increases the expression of Cyclin-G2 (CCNG2).	[47]
Estrone	DM5T6US	Approved	Estrone decreases the expression of Cyclin-G2 (CCNG2).	[30]
Mestranol	DMG3F94	Approved	Mestranol decreases the expression of Cyclin-G2 (CCNG2).	[30]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Cyclin-G2 (CCNG2).	[49]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Cyclin-G2 (CCNG2).	[37]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Cyclin-G2 (CCNG2).	[50]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Cyclin-G2 (CCNG2).	[30]
GDC0941	DM1YAK6	Phase 2	GDC0941 increases the expression of Cyclin-G2 (CCNG2).	[51]
GDC-0980/RG7422	DMF3MV1	Phase 2	GDC-0980/RG7422 increases the expression of Cyclin-G2 (CCNG2).	[51]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Cyclin-G2 (CCNG2).	[52]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Cyclin-G2 (CCNG2).	[53]
GSK618334	DMJPXZ4	Phase 1	GSK618334 increases the expression of Cyclin-G2 (CCNG2).	[47]
HEXESTROL	DM9AGWQ	Withdrawn from market	HEXESTROL decreases the expression of Cyclin-G2 (CCNG2).	[30]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Cyclin-G2 (CCNG2).	[54]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Cyclin-G2 (CCNG2).	[55]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Cyclin-G2 (CCNG2).	[56]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Cyclin-G2 (CCNG2).	[38]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Cyclin-G2 (CCNG2).	[57]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Cyclin-G2 (CCNG2).	[58]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Cyclin-G2 (CCNG2).	[47]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Cyclin-G2 (CCNG2).	[59]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride decreases the expression of Cyclin-G2 (CCNG2).	[60]
Rapamycin Immunosuppressant Drug	DM678IB	Investigative	Rapamycin Immunosuppressant Drug increases the expression of Cyclin-G2 (CCNG2).	[47]
1,4-Dithiothreitol	DMIFOXE	Investigative	1,4-Dithiothreitol increases the expression of Cyclin-G2 (CCNG2).	[54]

References

• [1] Cyclin G2 promotes hypoxia-driven local invasion of glioblastoma by orchestrating cytoskeletal dynamics.Neoplasia. 2013 Nov;15(11):1272-81. doi: 10.1593/neo.131440.
• [2] Importin-11 overexpression promotes the migration, invasion, and progression of bladder cancer associated with the deregulation of CDKN1A and THBS1.Urol Oncol. 2018 Jun;36(6):311.e1-311.e13. doi: 10.1016/j.urolonc.2018.03.001. Epub 2018 Mar 27.
• [3] CCNG2 Overexpression Mediated by AKT Inhibits Tumor Cell Proliferation in Human Astrocytoma Cells.Front Neurol. 2018 Apr 18;9:255. doi: 10.3389/fneur.2018.00255. eCollection 2018.
• [4] Changes in the expression of cyclin G2 in esophageal cancer cell and its significance.Tumour Biol. 2014 Apr;35(4):3355-62. doi: 10.1007/s13277-013-1442-3. Epub 2013 Dec 3.
• [5] MicroRNA-1246 promotes growth and metastasis of colorectal cancer cells involving CCNG2 reduction.Mol Med Rep. 2016 Jan;13(1):273-80. doi: 10.3892/mmr.2015.4557. Epub 2015 Nov 12.
• [6] Cyclin G2 Suppresses Glomerulosclerosis by Regulating Canonical Wnt Signalling.Biomed Res Int. 2018 Oct 21;2018:6938482. doi: 10.1155/2018/6938482. eCollection 2018.
• [7] Cyclin G2 inhibits epithelial-to-mesenchymal transition by disrupting Wnt/-catenin signaling.Oncogene. 2016 Sep 8;35(36):4816-27. doi: 10.1038/onc.2016.15. Epub 2016 Feb 15.
• [8] Effect of cyclin G2 on proliferative ability of SGC-7901 cell.World J Gastroenterol. 2004 May 1;10(9):1357-60. doi: 10.3748/wjg.v10.i9.1357.
• [9] Cyclin G2 Inhibits the Warburg Effect and Tumour Progression by Suppressing LDHA Phosphorylation in Glioma.Int J Biol Sci. 2019 Jan 1;15(3):544-555. doi: 10.7150/ijbs.30297. eCollection 2019.
• [10] CCNG2 and CDK4 is associated with insulin resistance in adipose tissue.Surg Obes Relat Dis. 2014 Jul-Aug;10(4):691-6. doi: 10.1016/j.soard.2013.12.011. Epub 2014 Jan 9.
• [11] Change in expression of cyclin G2 in kidney cancer cell and its significance.Tumour Biol. 2014 Apr;35(4):3177-83. doi: 10.1007/s13277-013-1415-6. Epub 2013 Nov 23.
• [12] Cyclin G2 dysregulation in human oral cancer.Cancer Res. 2004 Dec 15;64(24):8980-6. doi: 10.1158/0008-5472.CAN-04-1926.
• [13] Cyclin G2 is degraded through the ubiquitin-proteasome pathway and mediates the antiproliferative effect of activin receptor-like kinase 7.Mol Biol Cell. 2008 Nov;19(11):4968-79. doi: 10.1091/mbc.e08-03-0259. Epub 2008 Sep 10.
• [14] Genome-wide association analysis implicates the involvement of eight loci with response to tocilizumab for the treatment of rheumatoid arthritis.Pharmacogenomics J. 2013 Jun;13(3):235-41. doi: 10.1038/tpj.2012.8. Epub 2012 Apr 10.
• [15] MiR-1290 targets CCNG2 to promote the metastasis of oral squamous cell carcinoma.Eur Rev Med Pharmacol Sci. 2019 Dec;23(23):10332-10342. doi: 10.26355/eurrev_201912_19671.
• [16] Deregulated microRNAs in triple-negative breast cancer revealed by deep sequencing.Mol Cancer. 2015 Feb 10;14:36. doi: 10.1186/s12943-015-0301-9.
• [17] miR-1246 Targets CCNG2 to Enhance Cancer Stemness and Chemoresistance in Oral Carcinomas.Cancers (Basel). 2018 Aug 16;10(8):272. doi: 10.3390/cancers10080272.
• [18] MicroRNA-93 regulates cyclin G2 expression and plays an oncogenic role in laryngeal squamous cell carcinoma.Int J Oncol. 2015 Jan;46(1):161-74. doi: 10.3892/ijo.2014.2704. Epub 2014 Oct 10.
• [19] Vitamin K2 and cotylenin A synergistically induce monocytic differentiation and growth arrest along with the suppression of c-MYC expression and induction of cyclin G2 expression in human leukemia HL-60 cells.Int J Oncol. 2015 Aug;47(2):473-80. doi: 10.3892/ijo.2015.3028. Epub 2015 Jun 4.
• [20] The expression of cyclin G in nasopharyngeal carcinoma and its significance.Clin Exp Med. 2012 Mar;12(1):21-4. doi: 10.1007/s10238-011-0142-9. Epub 2011 Jun 19.
• [21] Transcriptional upregulation of histone deacetylase 2 promotes Myc-induced oncogenic effects.Oncogene. 2010 Nov 4;29(44):5957-68. doi: 10.1038/onc.2010.332. Epub 2010 Aug 9.
• [22] CCNG2 suppressor biological effects on thyroid cancer cell through promotion of CDK2 degradation.Asian Pac J Cancer Prev. 2013;14(10):6165-71. doi: 10.7314/apjcp.2013.14.10.6165.
• [23] Exosomal MicroRNA MiR-1246 Promotes Cell Proliferation, Invasion and Drug Resistance by Targeting CCNG2 in Breast Cancer.Cell Physiol Biochem. 2017;44(5):1741-1748. doi: 10.1159/000485780. Epub 2017 Dec 6.
• [24] Cyclin G2 suppresses Wnt/-catenin signaling and inhibits gastric cancer cell growth and migration through Dapper1.J Exp Clin Cancer Res. 2018 Dec 14;37(1):317. doi: 10.1186/s13046-018-0973-2.
• [25] Morin inhibited lung cancer cells viability, growth, and migration by suppressing miR-135b and inducing its target CCNG2.Tumour Biol. 2017 Oct;39(10):1010428317712443. doi: 10.1177/1010428317712443.
• [26] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [27] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [28] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [29] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [30] Moving toward integrating gene expression profiling into high-throughput testing: a gene expression biomarker accurately predicts estrogen receptor alpha modulation in a microarray compendium. Toxicol Sci. 2016 May;151(1):88-103.
• [31] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [32] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [33] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [34] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [35] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [36] Pharmacogenomic identification of novel determinants of response to chemotherapy in colon cancer. Cancer Res. 2006 Mar 1;66(5):2765-77.
• [37] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [38] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [39] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [40] Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
• [41] Cotylenin A, a new differentiation inducer, and rapamycin cooperatively inhibit growth of cancer cells through induction of cyclin G2. Cancer Sci. 2008 Aug;99(8):1693-8. doi: 10.1111/j.1349-7006.2008.00867.x.
• [42] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [43] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [44] Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
• [45] Differential regulation of the p73 cistrome by mammalian target of rapamycin reveals transcriptional programs of mesenchymal differentiation and tumorigenesis. Proc Natl Acad Sci U S A. 2011 Feb 1;108(5):2076-81. doi: 10.1073/pnas.1011936108. Epub 2011 Jan 18.
• [46] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [47] Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
• [48] Casodex treatment induces hypoxia-related gene expression in the LNCaP prostate cancer progression model. BMC Urol. 2005 Mar 24;5:5.
• [49] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [50] Impact of epigallocatechin gallate on gene expression profiles of human hepatocellular carcinoma cell lines BEL7404/ADM and BEL7402/5-FU. Ai Zheng. 2008 Oct;27(10):1056-64.
• [51] Phosphoinositide 3-kinase (PI3K) pathway alterations are associated with histologic subtypes and are predictive of sensitivity to PI3K inhibitors in lung cancer preclinical models. Clin Cancer Res. 2012 Dec 15;18(24):6771-83. doi: 10.1158/1078-0432.CCR-12-2347. Epub 2012 Nov 7.
• [52] Genome-wide transcriptional and functional analysis of human T lymphocytes treated with benzo[alpha]pyrene. Int J Mol Sci. 2018 Nov 17;19(11).
• [53] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [54] Transient receptor potential vanilloid 1 agonists cause endoplasmic reticulum stress and cell death in human lung cells. J Pharmacol Exp Ther. 2007 Jun;321(3):830-8. doi: 10.1124/jpet.107.119412. Epub 2007 Mar 1.
• [55] Evaluation of estrogen receptor alpha activation by glyphosate-based herbicide constituents. Food Chem Toxicol. 2017 Oct;108(Pt A):30-42.
• [56] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [57] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [58] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [59] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [60] Early gene response in lithium chloride induced apoptosis. Apoptosis. 2005 Jan;10(1):75-90. doi: 10.1007/s10495-005-6063-x.
• [61] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.