Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL0PFGV)

• DOT Name: E3 ubiquitin-protein ligase MYLIP (MYLIP)
• Synonyms: EC 2.3.2.27; Inducible degrader of the LDL-receptor; Idol; Myosin regulatory light chain interacting protein; MIR; RING-type E3 ubiquitin transferase MYLIP
• Gene Name: MYLIP
• Related Disease:
  Hypercholesterolemia, familial, 1
  Alzheimer disease
  B-cell lymphoma
  B-cell neoplasm
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Cardiomyopathy
  Cervical cancer
  Cervical carcinoma
  Clear cell renal carcinoma
  Dengue
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Ewing sarcoma
  Follicular lymphoma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  High blood pressure
  Huntington disease
  leukaemia
  Liver cirrhosis
  Metabolic disorder
  Neoplasm
  Non-alcoholic fatty liver disease
  Non-small-cell lung cancer
  Pancreatic cancer
  Plasma cell myeloma
  Renal cell carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Vascular disease
  Advanced cancer
  Chronic hepatitis B virus infection
  Chronic obstructive pulmonary disease
  Lung cancer
  Lung carcinoma
  Obesity
  Osteoarthritis
  Prostate cancer
  Prostate carcinoma
  Small lymphocytic lymphoma
  Endometriosis
  OPTN-related open angle glaucoma
  Coronary atherosclerosis
  Coronary heart disease
  Erectile dysfunction
  Hereditary breast carcinoma
  Metastatic malignant neoplasm
  Non-insulin dependent diabetes
• UniProt ID: MYLIP_HUMAN
• PDB ID: 2YHN; 2YHO; 6QLY; 6QLZ
• EC Number: 2.3.2.27
• Pfam ID: PF09380 ; PF00373 ; PF09379 ; PF13920
• Sequence:
  MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSKGESLWLNLRN
  RISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKEALLAGHLLCSPEQAVELS
  ALLAQTKFGDYNQNTAKYNYEELCAKELSSATLNSIVAKHKELEGTSQASAEYQVLQIVS
  AMENYGIEWHSVRDSEGQKLLIGVGPEGISICKDDFSPINRIAYPVVQMATQSGKNVYLT
  VTKESGNSIVLLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLF
  LNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRNNQSPSHSPLKSSESSMNC
  SSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPV
  CRSRVEHVQHVYLPTHTSLLNLTVI
• Function: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of myosin regulatory light chain (MRLC), LDLR, VLDLR and LRP8. Activity depends on E2 enzymes of the UBE2D family. Proteasomal degradation of MRLC leads to inhibit neurite outgrowth in presence of NGF by counteracting the stabilization of MRLC by saposin-like protein (CNPY2/MSAP) and reducing CNPY2-stimulated neurite outgrowth. Acts as a sterol-dependent inhibitor of cellular cholesterol uptake by mediating ubiquitination and subsequent degradation of LDLR.
• Tissue Specificity: Ubiquitously expressed.
• KEGG Pathway: Cholesterol metabolism (hsa04979)
• Reactome Pathway:
  NR1H2 & NR1H3 regulate gene expression to limit cholesterol uptake (R-HSA-9031525)
  Antigen processing (R-HSA-983168)
  VLDLR internalisation and degradation (R-HSA-8866427)

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hypercholesterolemia, familial, 1	DISU411W	Definitive	Genetic Variation	[1]
Alzheimer disease	DISF8S70	Strong	Biomarker	[2]
B-cell lymphoma	DISIH1YQ	Strong	Altered Expression	[3]
B-cell neoplasm	DISVY326	Strong	Genetic Variation	[4]
Bladder cancer	DISUHNM0	Strong	Biomarker	[5]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[6]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[6]
Cardiomyopathy	DISUPZRG	Strong	Genetic Variation	[7]
Cervical cancer	DISFSHPF	Strong	Genetic Variation	[8]
Cervical carcinoma	DIST4S00	Strong	Genetic Variation	[8]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[9]
Dengue	DISKH221	Strong	Altered Expression	[10]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[11]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[12]
Ewing sarcoma	DISQYLV3	Strong	Biomarker	[13]
Follicular lymphoma	DISVEUR6	Strong	Altered Expression	[3]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[15]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[16]
Huntington disease	DISQPLA4	Strong	Biomarker	[17]
leukaemia	DISS7D1V	Strong	Genetic Variation	[18]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[19]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[2]
Neoplasm	DISZKGEW	Strong	Altered Expression	[20]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[21]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[22]
Pancreatic cancer	DISJC981	Strong	Genetic Variation	[23]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[4]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[9]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[5]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[5]
Vascular disease	DISVS67S	Strong	Genetic Variation	[16]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[24]
Chronic hepatitis B virus infection	DISHL4NT	moderate	Genetic Variation	[25]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Genetic Variation	[26]
Lung cancer	DISCM4YA	moderate	Altered Expression	[27]
Lung carcinoma	DISTR26C	moderate	Altered Expression	[27]
Obesity	DIS47Y1K	moderate	Biomarker	[28]
Osteoarthritis	DIS05URM	moderate	Biomarker	[29]
Prostate cancer	DISF190Y	moderate	Biomarker	[30]
Prostate carcinoma	DISMJPLE	moderate	Biomarker	[30]
Small lymphocytic lymphoma	DIS30POX	moderate	Altered Expression	[31]
Endometriosis	DISX1AG8	Disputed	Biomarker	[32]
OPTN-related open angle glaucoma	DISDR98A	Disputed	Genetic Variation	[33]
Coronary atherosclerosis	DISKNDYU	Limited	Genetic Variation	[34]
Coronary heart disease	DIS5OIP1	Limited	Genetic Variation	[34]
Erectile dysfunction	DISD8MTH	Limited	Biomarker	[35]
Hereditary breast carcinoma	DISAEZT5	Limited	Genetic Variation	[36]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[37]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[38]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	E3 ubiquitin-protein ligase MYLIP (MYLIP) decreases the response to substance of Arsenic.	[67]
Mitomycin	DMH0ZJE	Approved	E3 ubiquitin-protein ligase MYLIP (MYLIP) affects the response to substance of Mitomycin.	[68]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[39]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[40]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[41]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[42]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[43]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[44]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[45]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[46]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[47]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[48]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[49]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[50]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil affects the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[51]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[52]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[53]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[54]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[55]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[52]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[56]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[52]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene decreases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[57]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[58]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[59]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[60]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[61]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[62]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[63]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[45]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[64]
GW-3965	DMG60ET	Investigative	GW-3965 increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[65]
T0901317	DMZQVDI	Investigative	T0901317 increases the expression of E3 ubiquitin-protein ligase MYLIP (MYLIP).	[66]

References

• [1] The MYLIP p.N342S polymorphism is associated with response to lipid-lowering therapy in Brazilian patients with familial hypercholesterolemia.Pharmacogenet Genomics. 2014 Nov;24(11):548-55. doi: 10.1097/FPC.0000000000000089.
• [2] The E3 ubiquitin ligase inducible degrader of the LDL receptor/myosin light chain interacting protein in health and disease.Curr Opin Lipidol. 2019 Jun;30(3):192-197. doi: 10.1097/MOL.0000000000000593.
• [3] Network analysis of microRNAs, genes and their regulation in diffuse and follicular B-cell lymphomas.Oncotarget. 2018 Jan 5;9(8):7928-7941. doi: 10.18632/oncotarget.23974. eCollection 2018 Jan 30.
• [4] Expression of hsa-MIR-204, RUNX2, PPAR, and BCL2 in Bone Marrow Derived Mesenchymal Stem Cells from Multiple Myeloma Patients and Normal Individuals.Cell J. 2017 Spring;19(Suppl 1):27-36. doi: 10.22074/cellj.2017.4480. Epub 2017 May 17.
• [5] MicroRNA-101 inhibits cell migration and invasion in bladder cancer via targeting FZD4.Exp Ther Med. 2019 Feb;17(2):1476-1485. doi: 10.3892/etm.2018.7084. Epub 2018 Dec 11.
• [6] Differential Expression of MicroRNAs in Breast Cancers from Four Different Ethnicities.Pathobiology. 2018;85(4):220-226. doi: 10.1159/000488456. Epub 2018 May 23.
• [7] Elucidation of transcriptome-wide microRNA binding sites in human cardiac tissues by Ago2 HITS-CLIP. Nucleic Acids Res. 2016 Sep 6;44(15):7120-31.
• [8] GRSF1-mediated MIR-G-1 promotes malignant behavior and nuclear autophagy by directly upregulating TMED5 and LMNB1 in cervical cancer cells.Autophagy. 2019 Apr;15(4):668-685. doi: 10.1080/15548627.2018.1539590. Epub 2018 Nov 5.
• [9] Linkage of microRNA and proteome-based profiling data sets: a perspective for the priorization of candidate biomarkers in renal cell carcinoma?.J Proteome Res. 2011 Jan 7;10(1):191-9. doi: 10.1021/pr1011137.
• [10] Dengue virus in Aedes aegypti and Aedes albopictus in urban areas in the state of Rio Grande do Norte, Brazil: Importance of virological and entomological surveillance.PLoS One. 2018 Mar 13;13(3):e0194108. doi: 10.1371/journal.pone.0194108. eCollection 2018.
• [11] MIR-92 stimulates VEGF by inhibiting von Hippel-Lindau gene product in epithelial ovarian cancer.J Biol Regul Homeost Agents. 2017 Jul-Sep,;31(3):615-624.
• [12] Genetic variation in miR-100 rs1834306 is associated with decreased risk for esophageal squamous cell carcinoma in Kazakh patients in northwest China.Int J Clin Exp Pathol. 2015 Jun 1;8(6):7332-40. eCollection 2015.
• [13] miR-185 suppresses progression of Ewing's sarcoma via inhibiting the PI3K/AKT and Wnt/-catenin pathways.Onco Targets Ther. 2018 Nov 9;11:7967-7977. doi: 10.2147/OTT.S167771. eCollection 2018.
• [14] Identification of an epigenetic profile classifier that is associated with survival in head and neck cancer.Cancer Res. 2012 Jun 1;72(11):2728-37. doi: 10.1158/0008-5472.CAN-11-4121-T. Epub 2012 Apr 16.
• [15] MicroRNA Gene Polymorphisms in Evaluating Therapeutic Efficacy After Transcatheter Arterial Chemoembolization for Primary Hepatocellular Carcinoma.Genet Test Mol Biomarkers. 2016 Oct;20(10):579-586. doi: 10.1089/gtmb.2016.0073. Epub 2016 Aug 15.
• [16] Associations of MicroRNA Polymorphisms (miR-146a, miR-196a2, and miR-499) with the Risk of Hypertension in the Korean Population.Genet Test Mol Biomarkers. 2016 Aug;20(8):420-6. doi: 10.1089/gtmb.2016.0039. Epub 2016 Jul 5.
• [17] Hsa-miR-34b is a plasma-stable microRNA that is elevated in pre-manifest Huntington's disease.Hum Mol Genet. 2011 Jun 1;20(11):2225-37. doi: 10.1093/hmg/ddr111. Epub 2011 Mar 19.
• [18] MicroRNA 146a Polymorphisms and Expression in Indian Children with Acute Lymphoblastic Leukemia.Lab Med. 2019 Jul 16;50(3):249-253. doi: 10.1093/labmed/lmy074.
• [19] Mid-infrared spectroscopy of serum, a promising non-invasive method to assess prognosis in patients with ascites and cirrhosis.PLoS One. 2017 Oct 11;12(10):e0185997. doi: 10.1371/journal.pone.0185997. eCollection 2017.
• [20] Cholesterol uptake and regulation in high-grade and lethal prostate cancers.Carcinogenesis. 2017 Aug 1;38(8):806-811. doi: 10.1093/carcin/bgx058.
• [21] miRNA-132 induces hepatic steatosis and hyperlipidaemia by synergistic multitarget suppression.Gut. 2018 Jun;67(6):1124-1134. doi: 10.1136/gutjnl-2016-312869. Epub 2017 Apr 5.
• [22] Axl-Targeted Delivery of the Oncosuppressor miR-137 in Non-small-Cell Lung Cancer.Mol Ther Nucleic Acids. 2019 Sep 6;17:256-263. doi: 10.1016/j.omtn.2019.06.002. Epub 2019 Jun 13.
• [23] Garcinol sensitizes human pancreatic adenocarcinoma cells to gemcitabine in association with microRNA signatures.Mol Nutr Food Res. 2013 Feb;57(2):235-48. doi: 10.1002/mnfr.201200297. Epub 2013 Jan 7.
• [24] Applications of mid-infrared spectroscopy in the clinical laboratory setting.Crit Rev Clin Lab Sci. 2018 Jan;55(1):1-20. doi: 10.1080/10408363.2017.1414142. Epub 2017 Dec 14.
• [25] Association of a variant in MIR 196A2 with susceptibility to hepatocellular carcinoma in male Chinese patients with chronic hepatitis B virus infection.Hum Immunol. 2010 Jun;71(6):621-6. doi: 10.1016/j.humimm.2010.02.017. Epub 2010 Mar 12.
• [26] Association of MicroRNA-196a2 Variant with Response to Short-Acting 2-Agonist in COPD: An Egyptian Pilot Study.PLoS One. 2016 Apr 4;11(4):e0152834. doi: 10.1371/journal.pone.0152834. eCollection 2016.
• [27] MicroRNA-125b may function as an oncogene in lung cancer cells.Mol Med Rep. 2015 May;11(5):3880-7. doi: 10.3892/mmr.2014.3142. Epub 2014 Dec 31.
• [28] The gut microbiota regulates white adipose tissue inflammation and obesity via a family of microRNAs.Sci Transl Med. 2019 Jun 12;11(496):eaav1892. doi: 10.1126/scitranslmed.aav1892.
• [29] The complex landscape of microRNAs in articular cartilage: biology, pathology, and therapeutic targets.JCI Insight. 2018 Sep 6;3(17):e121630. doi: 10.1172/jci.insight.121630. eCollection 2018 Sep 6.
• [30] CNPY2 inhibits MYLIP-mediated AR protein degradation in prostate cancer cells.Oncotarget. 2018 Apr 3;9(25):17645-17655. doi: 10.18632/oncotarget.24824. eCollection 2018 Apr 3.
• [31] Signal transducer and activator of transcription (STAT)-3 regulates microRNA gene expression in chronic lymphocytic leukemia cells.Mol Cancer. 2013 Jun 1;12:50. doi: 10.1186/1476-4598-12-50.
• [32] Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
• [33] A Common Variant in MIR182 Is Associated With Primary Open-Angle Glaucoma in the NEIGHBORHOOD Consortium.Invest Ophthalmol Vis Sci. 2016 Aug 1;57(10):4528-4535. doi: 10.1167/iovs.16-19688.
• [34] Novel genes in LDL metabolism--a comprehensive overview.Curr Opin Lipidol. 2015 Jun;26(3):179-87. doi: 10.1097/MOL.0000000000000175.
• [35] The Changes of MicroRNA Expression in the Corpus Cavernosum of a Rat Model With Cavernous Nerve Injury.J Sex Med. 2018 Jul;15(7):958-965. doi: 10.1016/j.jsxm.2018.05.006.
• [36] Mutation screening of MIR146A/B and BRCA1/2 3'-UTRs in the GENESIS study.Eur J Hum Genet. 2016 Aug;24(9):1324-9. doi: 10.1038/ejhg.2015.284. Epub 2016 Jan 20.
• [37] Combined Effect of Metastasis-Related MicroRNA, miR-34 and miR-124 Family, Methylation on Prognosis of Non-Small-Cell Lung Cancer.Clin Lung Cancer. 2017 Jan;18(1):e13-e20. doi: 10.1016/j.cllc.2016.06.005. Epub 2016 Jun 23.
• [38] MicroRNA genetic variations: association with type 2 diabetes.Acta Diabetol. 2013 Dec;50(6):867-72. doi: 10.1007/s00592-013-0469-7. Epub 2013 Mar 27.
• [39] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [40] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [41] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [42] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [43] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [44] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [45] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [46] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [47] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [48] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [49] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [50] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [51] Multi-level gene expression profiles affected by thymidylate synthase and 5-fluorouracil in colon cancer. BMC Genomics. 2006 Apr 3;7:68. doi: 10.1186/1471-2164-7-68.
• [52] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [53] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [54] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [55] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [56] The molecular basis of genistein-induced mitotic arrest and exit of self-renewal in embryonal carcinoma and primary cancer cell lines. BMC Med Genomics. 2008 Oct 10;1:49.
• [57] Gene expression preferentially regulated by tamoxifen in breast cancer cells and correlations with clinical outcome. Cancer Res. 2006 Jul 15;66(14):7334-40.
• [58] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [59] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [60] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [61] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [62] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [63] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [64] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [65] Identification of a Chrysanthemic Ester as an Apolipoprotein E Inducer in Astrocytes. PLoS One. 2016 Sep 6;11(9):e0162384. doi: 10.1371/journal.pone.0162384. eCollection 2016.
• [66] The liver X receptors and sterol regulatory element binding proteins alter progesterone secretion and are regulated by human chorionic gonadotropin in human luteinized granulosa cells. Mol Cell Endocrinol. 2018 Sep 15;473:124-135. doi: 10.1016/j.mce.2018.01.011. Epub 2018 Jan 31.
• [67] Gene expression levels in normal human lymphoblasts with variable sensitivities to arsenite: identification of GGT1 and NFKBIE expression levels as possible biomarkers of susceptibility. Toxicol Appl Pharmacol. 2008 Jan 15;226(2):199-205. doi: 10.1016/j.taap.2007.09.004. Epub 2007 Sep 15.
• [68] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.