Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTM64N7K)

• DOT Name: T-box transcription factor TBX3 (TBX3)
• Synonyms: T-box protein 3
• Gene Name: TBX3
• Related Disease:
  Arrhythmia
  Breast neoplasm
  Fibrosarcoma
  Liver cancer
  Ovarian neoplasm
  Thyroid gland papillary carcinoma
  Ulnar-mammary syndrome
  Acute respiratory failure
  Advanced cancer
  Arthritis
  Bladder cancer
  Carcinoma of liver and intrahepatic biliary tract
  Colon cancer
  Colorectal adenocarcinoma
  Colorectal cancer
  Colorectal cancer, susceptibility to, 1
  Colorectal cancer, susceptibility to, 10
  Colorectal cancer, susceptibility to, 12
  Colorectal carcinoma
  Colorectal neoplasm
  Congenital deformities of limbs
  Ductal breast carcinoma in situ
  Hepatocellular carcinoma
  High blood pressure
  Invasive breast carcinoma
  Melanoma
  Neoplasm
  Nephropathy
  Non-small-cell lung cancer
  Pancreatic cancer
  Prostate cancer
  Prostate neoplasm
  Renal cell carcinoma
  Rheumatic fever
  Rheumatoid arthritis
  Stomach cancer
  Stroke
  Urinary bladder cancer
  Urinary bladder neoplasm
  Benign prostatic hyperplasia
  Carcinoma
  Ventricular septal defect
  Gastric cancer
  Gastric neoplasm
  Head-neck squamous cell carcinoma
  Heart arrhythmia
  Hereditary diffuse gastric adenocarcinoma
  Intellectual disability
  Myocardial infarction
• UniProt ID: TBX3_HUMAN
• PDB ID: 1H6F
• Pfam ID: PF00907 ; PF12598 ; PF20627
• Sequence:
  MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGAL
  AKPIMDQLVGAAETGIPFSSLGPQAHLRPLKTMEPEEEVEDDPKVHLEAKELWDQFHKRG
  TEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEM
  PKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQT
  ILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFA
  KGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNCFAQASSPAASTV
  GTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAE
  RPRDSGRLDKASPDSRHSPATISSSTRGLGAEERRSPVREGTAPAKVEEARALPGKEAFA
  PLTVQTDAAAAHLAQGPLPGLGFAPGLAGQQFFNGHPLFLHPSQFAMGGAFSSMAAAGMG
  PLLATVSGASTGVSGLDSTAMASAAAAQGLSGASAATLPFHLQQHVLASQGLAMSPFGSL
  FPYPYTYMAAAAAASSAAASSSVHRHPFLNLNTMRPRLRYSPYSIPVPVPDGSSLLTTAL
  PSMAAAAGPLDGKVAALAASPASVAVDSGSELNSRSSTLSSSSMSLSPKLCAEKEAATSE
  LQSIQRLVSGLEAKPDRSRSASP
• Function: Transcriptional repressor involved in developmental processes. Binds to the palindromic T site 5'-TTCACACCTAGGTGTGAA-3' DNA sequence, or a half-site, which are present in the regulatory region of several genes. Probably plays a role in limb pattern formation. Required for mammary placode induction, and maintenance of the mammary buds during development. Involved in branching morphogenesis in both developing lungs and adult mammary glands, via negative modulation of target genes; acting redundantly with TBX2. Required, together with TBX2, to maintain cell proliferation in the embryonic lung mesenchyme; perhaps acting downstream of SHH, BMP and TGFbeta signaling. Involved in modulating early inner ear development, acting independently of, and also redundantly with, TBX2 in different subregions of the developing ear. Acts as a negative regulator of PML function in cellular senescence.
• Tissue Specificity: Widely expressed.
• KEGG Pathway: Sig.ling pathways regulating pluripotency of stem cells (hsa04550)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Arrhythmia	DISFF2NI	Definitive	Altered Expression	[1]
Breast neoplasm	DISNGJLM	Definitive	Biomarker	[2]
Fibrosarcoma	DISWX7MU	Definitive	Biomarker	[3]
Liver cancer	DISDE4BI	Definitive	Altered Expression	[4]
Ovarian neoplasm	DISEAFTY	Definitive	Altered Expression	[5]
Thyroid gland papillary carcinoma	DIS48YMM	Definitive	Biomarker	[6]
Ulnar-mammary syndrome	DIS8T08U	Definitive	Autosomal dominant	[7]
Acute respiratory failure	DIS5KQ5Y	Strong	Altered Expression	[8]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[9]
Arthritis	DIST1YEL	Strong	Genetic Variation	[10]
Bladder cancer	DISUHNM0	Strong	Posttranslational Modification	[11]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Biomarker	[12]
Colon cancer	DISVC52G	Strong	Genetic Variation	[13]
Colorectal adenocarcinoma	DISPQOUB	Strong	Genetic Variation	[13]
Colorectal cancer	DISNH7P9	Strong	Genetic Variation	[13]
Colorectal cancer, susceptibility to, 1	DISZ794C	Strong	Genetic Variation	[13]
Colorectal cancer, susceptibility to, 10	DISQXMYM	Strong	Genetic Variation	[13]
Colorectal cancer, susceptibility to, 12	DIS4FXJX	Strong	Genetic Variation	[13]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[13]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[13]
Congenital deformities of limbs	DISP4N1Q	Strong	Genetic Variation	[14]
Ductal breast carcinoma in situ	DISLCJY7	Strong	Altered Expression	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[16]
High blood pressure	DISY2OHH	Strong	Biomarker	[17]
Invasive breast carcinoma	DISANYTW	Strong	Biomarker	[15]
Melanoma	DIS1RRCY	Strong	Altered Expression	[4]
Neoplasm	DISZKGEW	Strong	Biomarker	[9]
Nephropathy	DISXWP4P	Strong	Biomarker	[18]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[19]
Pancreatic cancer	DISJC981	Strong	Biomarker	[20]
Prostate cancer	DISF190Y	Strong	Biomarker	[21]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[21]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[22]
Rheumatic fever	DISLUF66	Strong	Altered Expression	[8]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[10]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[23]
Stroke	DISX6UHX	Strong	Biomarker	[24]
Urinary bladder cancer	DISDV4T7	Strong	Posttranslational Modification	[11]
Urinary bladder neoplasm	DIS7HACE	Strong	Posttranslational Modification	[11]
Benign prostatic hyperplasia	DISI3CW2	moderate	Genetic Variation	[25]
Carcinoma	DISH9F1N	moderate	Altered Expression	[26]
Ventricular septal defect	DISICO41	Disputed	Genetic Variation	[27]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[23]
Gastric neoplasm	DISOKN4Y	Limited	Biomarker	[28]
Head-neck squamous cell carcinoma	DISF7P24	Limited	Altered Expression	[4]
Heart arrhythmia	DISLKUNL	Limited	Autosomal dominant	[29]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Limited	Biomarker	[28]
Intellectual disability	DISMBNXP	Limited	Genetic Variation	[30]
Myocardial infarction	DIS655KI	Limited	Biomarker	[31]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	T-box transcription factor TBX3 (TBX3) affects the response to substance of Temozolomide.	[55]
DTI-015	DMXZRW0	Approved	T-box transcription factor TBX3 (TBX3) affects the response to substance of DTI-015.	[55]

23 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of T-box transcription factor TBX3 (TBX3).	[32]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of T-box transcription factor TBX3 (TBX3).	[33]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of T-box transcription factor TBX3 (TBX3).	[34]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of T-box transcription factor TBX3 (TBX3).	[35]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of T-box transcription factor TBX3 (TBX3).	[36]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of T-box transcription factor TBX3 (TBX3).	[37]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of T-box transcription factor TBX3 (TBX3).	[38]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of T-box transcription factor TBX3 (TBX3).	[28]
Panobinostat	DM58WKG	Approved	Panobinostat affects the expression of T-box transcription factor TBX3 (TBX3).	[40]
Sulindac	DM2QHZU	Approved	Sulindac increases the expression of T-box transcription factor TBX3 (TBX3).	[41]
Methimazole	DM25FL8	Approved	Methimazole increases the expression of T-box transcription factor TBX3 (TBX3).	[42]
Propylthiouracil	DM6D7N8	Approved	Propylthiouracil increases the expression of T-box transcription factor TBX3 (TBX3).	[42]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of T-box transcription factor TBX3 (TBX3).	[43]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of T-box transcription factor TBX3 (TBX3).	[42]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of T-box transcription factor TBX3 (TBX3).	[44]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of T-box transcription factor TBX3 (TBX3).	[46]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of T-box transcription factor TBX3 (TBX3).	[47]
PF-3758309	DM36PKZ	Phase 1	PF-3758309 increases the expression of T-box transcription factor TBX3 (TBX3).	[48]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of T-box transcription factor TBX3 (TBX3).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of T-box transcription factor TBX3 (TBX3).	[51]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of T-box transcription factor TBX3 (TBX3).	[52]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of T-box transcription factor TBX3 (TBX3).	[53]
eucalyptol	DME5CK3	Investigative	eucalyptol affects the expression of T-box transcription factor TBX3 (TBX3).	[54]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of T-box transcription factor TBX3 (TBX3).	[45]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of T-box transcription factor TBX3 (TBX3).	[50]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of T-box transcription factor TBX3 (TBX3).	[50]

References

• [1] Fetal Arrhythmias: Genetic Background and Clinical Implications.Pediatr Cardiol. 2019 Feb;40(2):247-256. doi: 10.1007/s00246-018-2008-3. Epub 2018 Nov 26.
• [2] Regulation of the T-box transcription factor Tbx3 by the tumour suppressor microRNA-206 in breast cancer.Br J Cancer. 2016 May 10;114(10):1125-34. doi: 10.1038/bjc.2016.73. Epub 2016 Apr 21.
• [3] COL1A2 is a TBX3 target that mediates its impact on fibrosarcoma and chondrosarcoma cell migration.Cancer Lett. 2019 Sep 10;459:227-239. doi: 10.1016/j.canlet.2019.06.004. Epub 2019 Jun 13.
• [4] The special stemness functions of Tbx3 in stem cells and cancer development.Semin Cancer Biol. 2019 Aug;57:105-110. doi: 10.1016/j.semcancer.2018.09.010. Epub 2018 Sep 27.
• [5] Increased expression of cSHMT, Tbx3 and utrophin in plasma of ovarian and breast cancer patients.Int J Cancer. 2006 Jan 15;118(2):412-21. doi: 10.1002/ijc.21332.
• [6] TBX3 promotes proliferation of papillary thyroid carcinoma cells through facilitating PRC2-mediated p57(KIP2) repression.Oncogene. 2018 May;37(21):2773-2792. doi: 10.1038/s41388-017-0090-2. Epub 2018 Mar 7.
• [7] Ulnar Mammary syndrome and TBX3: expanding the phenotype. Am J Med Genet A. 2009 Dec;149A(12):2809-12. doi: 10.1002/ajmg.a.33096.
• [8] TBX3 is overexpressed in breast cancer and represses p14 ARF by interacting with histone deacetylases.Cancer Res. 2008 Feb 1;68(3):693-9. doi: 10.1158/0008-5472.CAN-07-5012.
• [9] The roles and regulation of TBX3 in development and disease.Gene. 2020 Feb 5;726:144223. doi: 10.1016/j.gene.2019.144223. Epub 2019 Oct 26.
• [10] The oncoprotein TBX3 is controlling severity in experimental arthritis.Arthritis Res Ther. 2019 Jan 10;21(1):16. doi: 10.1186/s13075-018-1797-3.
• [11] Stratification based on methylation of TBX2 and TBX3 into three molecular grades predicts progression in patients with pTa-bladder cancer.Mod Pathol. 2015 Apr;28(4):515-22. doi: 10.1038/modpathol.2014.145. Epub 2014 Nov 14.
• [12] Apicidin-resistant HA22T hepatocellular carcinoma cells strongly activated the Wnt/-catenin signaling pathway and MMP-2 expression via the IGF-IR/PI3K/Akt signaling pathway enhancing cell metastatic effect.Biosci Biotechnol Biochem. 2013;77(12):2397-404. doi: 10.1271/bbb.130503. Epub 2013 Dec 7.
• [13] Identification of Genetic Susceptibility Loci for Colorectal Tumors in a Genome-Wide Meta-analysis.Gastroenterology. 2013 Apr;144(4):799-807.e24. doi: 10.1053/j.gastro.2012.12.020. Epub 2012 Dec 22.
• [14] Hypogonadotropic hypogonadism and pituitary hypoplasia as recurrent features in Ulnar-Mammary syndrome.Endocr Connect. 2018 Dec 1;7(12):1432-1441. doi: 10.1530/EC-18-0486.
• [15] TBX3 promotes progression of pre-invasive breast cancer cells by inducing EMT and directly up-regulating SLUG.J Pathol. 2019 Jun;248(2):191-203. doi: 10.1002/path.5245. Epub 2019 Apr 8.
• [16] T-box Transcription Factor Tbx3 Contributes to Human Hepatocellular Carcinoma Cell Migration and Invasion by Repressing E-Cadherin Expression.Oncol Res. 2018 Jul 5;26(6):959-966. doi: 10.3727/096504017X15145624664031. Epub 2018 Jan 2.
• [17] Genome-wide association study of blood pressure and hypertension.Nat Genet. 2009 Jun;41(6):677-87. doi: 10.1038/ng.384. Epub 2009 May 10.
• [18] TBX3, a downstream target of TGF-1, inhibits mesangial cell apoptosis.Exp Cell Res. 2014 Nov 1;328(2):340-50. doi: 10.1016/j.yexcr.2014.08.022. Epub 2014 Aug 23.
• [19] T-box 3 overexpression is associated with poor prognosis of non-small cell lung cancer.Oncol Lett. 2017 May;13(5):3335-3341. doi: 10.3892/ol.2017.5855. Epub 2017 Mar 13.
• [20] Tbx3 fosters pancreatic cancer growth by increased angiogenesis and activin/nodal-dependent induction of stemness.Stem Cell Res. 2016 Sep;17(2):367-378. doi: 10.1016/j.scr.2016.08.007. Epub 2016 Aug 10.
• [21] Sequencing of prostate cancers identifies new cancer genes, routes of progression and drug targets.Nat Genet. 2018 May;50(5):682-692. doi: 10.1038/s41588-018-0086-z. Epub 2018 Apr 16.
• [22] Expression level of TBX3 gene in renal carcinoma and its clinical significance.Oncol Lett. 2018 Apr;15(4):4235-4240. doi: 10.3892/ol.2018.7841. Epub 2018 Jan 22.
• [23] Tbx3 overexpression in human gastric cancer is correlated with advanced tumor stage and nodal status and promotes cancer cell growth and invasion.Virchows Arch. 2016 Nov;469(5):505-513. doi: 10.1007/s00428-016-2007-9. Epub 2016 Aug 24.
• [24] Multiancestry genome-wide association study of 520,000 subjects identifies 32 loci associated with stroke and stroke subtypes.Nat Genet. 2018 Apr;50(4):524-537. doi: 10.1038/s41588-018-0058-3. Epub 2018 Mar 12.
• [25] Genome-wide associations for benign prostatic hyperplasia reveal a genetic correlation with serum levels of PSA.Nat Commun. 2018 Nov 8;9(1):4568. doi: 10.1038/s41467-018-06920-9.
• [26] The T-Box transcription factor 3 in development and cancer.Biosci Trends. 2017 Jul 24;11(3):254-266. doi: 10.5582/bst.2017.01043. Epub 2017 Jun 4.
• [27] Genetic analysis of the TBX3 gene promoter in ventricular septal defects.Gene. 2013 Jan 10;512(2):185-8. doi: 10.1016/j.gene.2012.10.066. Epub 2012 Oct 29.
• [28] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
• [29] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [30] Ulnar-mammary syndrome with dysmorphic facies and mental retardation caused by a novel 1.28 Mb deletion encompassing the TBX3 gene.Eur J Hum Genet. 2006 Dec;14(12):1274-9. doi: 10.1038/sj.ejhg.5201696. Epub 2006 Aug 9.
• [31] Estrogen receptor alpha supports cardiomyocytes indirectly through post-infarct cardiac c-kit+ cells.J Mol Cell Cardiol. 2009 Jul;47(1):66-75. doi: 10.1016/j.yjmcc.2009.03.014. Epub 2009 Mar 31.
• [32] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [33] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [34] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [35] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [36] Bisphenol A promotes human prostate stem-progenitor cell self-renewal and increases in vivo carcinogenesis in human prostate epithelium. Endocrinology. 2014 Mar;155(3):805-17. doi: 10.1210/en.2013-1955. Epub 2014 Jan 1.
• [37] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [38] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [39] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
• [40] The Bromodomain Inhibitor JQ1 and the Histone Deacetylase Inhibitor Panobinostat Synergistically Reduce N-Myc Expression and Induce Anticancer Effects. Clin Cancer Res. 2016 May 15;22(10):2534-44. doi: 10.1158/1078-0432.CCR-15-1666. Epub 2016 Jan 5.
• [41] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [42] Monitoring of deiodinase deficiency based on transcriptomic responses in SH-SY5Y cells. Arch Toxicol. 2013 Jun;87(6):1103-13. doi: 10.1007/s00204-013-1018-4. Epub 2013 Feb 10.
• [43] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [44] PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
• [45] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [46] Loss of TRIM33 causes resistance to BET bromodomain inhibitors through MYC- and TGF-beta-dependent mechanisms. Proc Natl Acad Sci U S A. 2016 Aug 2;113(31):E4558-66.
• [47] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [48] Inhibition of neuroblastoma proliferation by PF-3758309, a small-molecule inhibitor that targets p21-activated kinase 4. Oncol Rep. 2017 Nov;38(5):2705-2716. doi: 10.3892/or.2017.5989. Epub 2017 Sep 22.
• [49] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [50] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [51] Epigenetic influences of low-dose bisphenol A in primary human breast epithelial cells. Toxicol Appl Pharmacol. 2010 Oct 15;248(2):111-21.
• [52] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [53] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [54] Transcriptome Analysis Reveals the Anti-Tumor Mechanism of Eucalyptol Treatment on Neuroblastoma Cell Line SH-SY5Y. Neurochem Res. 2022 Dec;47(12):3854-3862. doi: 10.1007/s11064-022-03786-8. Epub 2022 Nov 4.
• [55] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.