Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWH8762)

• DOT Name: Sorbin and SH3 domain-containing protein 1 (SORBS1)
• Synonyms: Ponsin; SH3 domain protein 5; SH3P12; c-Cbl-associated protein; CAP
• Gene Name: SORBS1
• Related Disease:
  Tuberculosis
  Acute leukaemia
  Advanced cancer
  Arrhythmia
  Bacteremia
  Beta thalassemia
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cardiovascular disease
  Chromosomal disorder
  Colitis
  Diabetic kidney disease
  Epilepsy
  Fatty liver disease
  Hepatitis B virus infection
  Hepatocellular carcinoma
  High blood pressure
  Huntington disease
  Mantle cell lymphoma
  Neoplasm
  Non-alcoholic fatty liver disease
  Non-insulin dependent diabetes
  Perry syndrome
  Pneumonia
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Schizophrenia
  Thalassemia
  Type-1 diabetes
  Adult glioblastoma
  Glioblastoma multiforme
  Influenza
  Invasive breast carcinoma
  Methicillin-resistant staphylococci infection
  Aplastic anemia
  Epithelial ovarian cancer
  Acute myelogenous leukaemia
  Asthma
  Bone osteosarcoma
  Gastric cancer
  Metastatic malignant neoplasm
  Obesity
  Osteosarcoma
  Stomach cancer
  Stroke
• UniProt ID: SRBS1_HUMAN
• PDB ID: 2DL3; 2ECZ; 2LJ0; 2LJ1; 2MOX; 2O2W; 2O31; 2O9S; 2O9V; 4LN2; 4LNP
• Pfam ID: PF00018 ; PF07653 ; PF14604 ; PF02208
• Sequence:
  MSSECDGGSKAVMNGLAPGSNGQDKATADPLRARSISAVKIIPVKTVKNASGLVLPTDMD
  LTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKPGLEPEPSSADEWRLSSSADA
  NGNAQPSSLAAKGYRSVHPNLPSDKSQDATSSSAAQPEVIVVPLYLVNTDRGQEGTARPP
  TPLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPS
  FSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPSVSKPSSA
  YPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDSAPTQEKPTSPGKAIEKRAK
  DDSRRVVKSTQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDTPEENPYFPTYK
  FPELPEIQQTSEEDNPYTPTYQFPASTPSPKSEDDDSDLYSPRYSFSEDTKSPLSVPRSK
  SEMSYIDGEKVVKRSATLPLPARSSSLKSSSERNDWEPPDKKVDTRKYRAEPKSIYEYQP
  GKSSVLTNEKMSRDISPEEIDLKNEPWYKFFSELEFGKPPPKKIWDYTPGDCSILPREDR
  KTNLDKDLSLCQTELEADLEKMETLNKAPSANVPQSSAISPTPEISSETPGYIYSSNFHA
  VKRESDGAPGDLTSLENERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKDSESPRHFIPA
  DYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDL
  LNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVG
  IFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQV
  DENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYMDLPFSSSPSRSATASPQFSSHS
  KLITPAPSSLPHSRRALSPEMHAVTSEWISLTVGVPGRRSLALTPPLPPLPEASIYNTDH
  LALSPRASPSLSLSLPHLSWSDRPTPRSVASPLALPSPHKTYSLAPTSQASLHMNGDGGV
  HTPSSGIHQDSFLQLPLGSSDSVISQLSDAFSSQSKRQPWREESGQYERKAERGAGERGP
  GGPKISKKSCLKPSDVVRCLSTEQRLSDLNTPEESRPGKPLGSAFPGSEAEQTERHRGGE
  QAGRKAARRGGSQQPQAQQRRVTPDRSQTSQDLFSYQALYSYIPQNDDELELRDGDIVDV
  MEKCDDGWFVGTSRRTKQFGTFPGNYVKPLYL
• Function: Plays a role in tyrosine phosphorylation of CBL by linking CBL to the insulin receptor. Required for insulin-stimulated glucose transport. Involved in formation of actin stress fibers and focal adhesions.
• Tissue Specificity: Detected in skeletal muscle (at protein level). Widely expressed with highest levels in heart and skeletal muscle.
• KEGG Pathway:
  PPAR sig.ling pathway (hsa03320)
  Adherens junction (hsa04520)
  Insulin sig.ling pathway (hsa04910)
• Reactome Pathway: Smooth Muscle Contraction (R-HSA-445355)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Tuberculosis	DIS2YIMD	Definitive	Biomarker	[1]
Acute leukaemia	DISDQFDI	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Arrhythmia	DISFF2NI	Strong	Genetic Variation	[4]
Bacteremia	DIS6N9RZ	Strong	Genetic Variation	[5]
Beta thalassemia	DIS5RCQK	Strong	Genetic Variation	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[8]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[9]
Chromosomal disorder	DISM5BB5	Strong	Biomarker	[10]
Colitis	DISAF7DD	Strong	Genetic Variation	[11]
Diabetic kidney disease	DISJMWEY	Strong	Genetic Variation	[12]
Epilepsy	DISBB28L	Strong	Biomarker	[13]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[14]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[16]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[17]
Huntington disease	DISQPLA4	Strong	Biomarker	[18]
Mantle cell lymphoma	DISFREOV	Strong	Biomarker	[19]
Neoplasm	DISZKGEW	Strong	Biomarker	[20]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[21]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[22]
Perry syndrome	DIS8YKKM	Strong	Genetic Variation	[23]
Pneumonia	DIS8EF3M	Strong	Biomarker	[24]
Prostate cancer	DISF190Y	Strong	Biomarker	[25]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[25]
Prostate neoplasm	DISHDKGQ	Strong	Genetic Variation	[26]
Schizophrenia	DISSRV2N	Strong	Altered Expression	[27]
Thalassemia	DIS76XZB	Strong	Genetic Variation	[28]
Type-1 diabetes	DIS7HLUB	Strong	Genetic Variation	[12]
Adult glioblastoma	DISVP4LU	moderate	Biomarker	[29]
Glioblastoma multiforme	DISK8246	moderate	Biomarker	[29]
Influenza	DIS3PNU3	moderate	Biomarker	[30]
Invasive breast carcinoma	DISANYTW	moderate	Biomarker	[31]
Methicillin-resistant staphylococci infection	DIS6DRDZ	moderate	Biomarker	[32]
Aplastic anemia	DISJRSC0	Disputed	Biomarker	[33]
Epithelial ovarian cancer	DIS56MH2	Disputed	Genetic Variation	[34]
Acute myelogenous leukaemia	DISCSPTN	Limited	Genetic Variation	[35]
Asthma	DISW9QNS	Limited	Biomarker	[36]
Bone osteosarcoma	DIST1004	Limited	Biomarker	[37]
Gastric cancer	DISXGOUK	Limited	Genetic Variation	[38]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[39]
Obesity	DIS47Y1K	Limited	Biomarker	[40]
Osteosarcoma	DISLQ7E2	Limited	Biomarker	[37]
Stomach cancer	DISKIJSX	Limited	Genetic Variation	[38]
Stroke	DISX6UHX	Limited	Biomarker	[41]

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	Sorbin and SH3 domain-containing protein 1 (SORBS1) affects the response to substance of Etoposide.	[66]
Mitomycin	DMH0ZJE	Approved	Sorbin and SH3 domain-containing protein 1 (SORBS1) affects the response to substance of Mitomycin.	[66]
Mitoxantrone	DMM39BF	Approved	Sorbin and SH3 domain-containing protein 1 (SORBS1) affects the response to substance of Mitoxantrone.	[66]

23 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[42]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[43]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[44]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[45]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[48]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[49]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[50]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[51]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[52]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[53]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[54]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[55]
Rifampicin	DM5DSFZ	Approved	Rifampicin decreases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[56]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[57]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[58]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[59]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[60]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[61]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[62]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[52]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[63]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[64]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN affects the expression of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[65]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[46]
Quercetin	DM3NC4M	Approved	Quercetin increases the phosphorylation of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[47]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Sorbin and SH3 domain-containing protein 1 (SORBS1).	[47]

References

• [1] Diagnostic accuracy study of multiplex PCR for detecting tuberculosis drug resistance.J Infect. 2015 Aug;71(2):220-30. doi: 10.1016/j.jinf.2015.03.011. Epub 2015 Apr 30.
• [2] Risk factors and coping strategies of severe community-acquired pneumonia in chemotherapy induction period of acute leukemia.Oncol Lett. 2018 Mar;15(3):3566-3571. doi: 10.3892/ol.2018.7731. Epub 2018 Jan 4.
• [3] Multi-Institutional Evaluation of Interrater Agreement of Variant Classification Based on the 2017 Association for Molecular Pathology, American Society of Clinical Oncology, and College of American Pathologists Standards and Guidelines for the Interpretation and Reporting of Sequence Variants in Cancer.J Mol Diagn. 2020 Feb;22(2):284-293. doi: 10.1016/j.jmoldx.2019.10.010. Epub 2019 Dec 16.
• [4] Quality of life benefits from arrhythmia ablation: A longitudinal study using the C-CAP questionnaire and EQ5D.Pacing Clin Electrophysiol. 2019 Jun;42(6):705-711. doi: 10.1111/pace.13675. Epub 2019 Apr 17.
• [5] The efficacy and safety of tigecycline for the treatment of bloodstream infections: a systematic review and meta-analysis.Ann Clin Microbiol Antimicrob. 2017 Apr 5;16(1):24. doi: 10.1186/s12941-017-0199-8.
• [6] A beta-thalassaemia phenotype not linked to the beta-globin cluster in an Italian family.Br J Haematol. 1992 Jun;81(2):283-7. doi: 10.1111/j.1365-2141.1992.tb08221.x.
• [7] MiR-142-5p Acts as a Significant Regulator Through Promoting Proliferation, Invasion, and Migration in Breast Cancer Modulated by Targeting SORBS1.Technol Cancer Res Treat. 2019 Jan-Dec;18:1533033819892264. doi: 10.1177/1533033819892264.
• [8] Antineoplastic effect of pectic polysaccharides from green sweet pepper (Capsicum annuum) on mammary tumor cells in vivo and in vitro.Carbohydr Polym. 2018 Dec 1;201:280-292. doi: 10.1016/j.carbpol.2018.08.071. Epub 2018 Aug 20.
• [9] Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
• [10] LS-CAP: an algorithm for identifying cytogenetic aberrations in hepatocellular carcinoma using microarray data.Front Biosci. 2006 May 1;11:1311-22. doi: 10.2741/1885.
• [11] In situ self-spray coating system that can uniformly disperse a poorly water-soluble H(2)S donor on the colorectal surface to treat inflammatory bowel diseases.Biomaterials. 2018 Nov;182:289-298. doi: 10.1016/j.biomaterials.2018.07.044. Epub 2018 Aug 16.
• [12] SORBS1 gene, a new candidate for diabetic nephropathy: results from a multi-stage genome-wide association study in patients with type 1 diabetes.Diabetologia. 2015 Mar;58(3):543-8. doi: 10.1007/s00125-014-3459-6. Epub 2014 Dec 6.
• [13] Earlyonset epilepsy and microcephalycapillary malformation syndrome caused by a novel STAMBP mutation in a Chinese boy.Mol Med Rep. 2019 Dec;20(6):5145-5151. doi: 10.3892/mmr.2019.10757. Epub 2019 Oct 17.
• [14] Effect of Non-alcoholic Fatty Liver Disease on Transaminase Levels and Transient Elastography in Patients with Chronic Hepatitis B.Cureus. 2019 Oct 25;11(10):e5995. doi: 10.7759/cureus.5995.
• [15] Development of a new duplex real-time polymerase chain reaction assay for hepatitis B viral DNA detection.Virol J. 2011 May 14;8:227. doi: 10.1186/1743-422X-8-227.
• [16] Production and evaluation of chicken egg-yolk-derived antibodies against Campylobacter jejuni colonization-associated proteins.Foodborne Pathog Dis. 2013 Jul;10(7):624-31. doi: 10.1089/fpd.2012.1313. Epub 2013 Jun 6.
• [17] Genetic Variation in the Human SORBS1 Gene is Associated With Blood Pressure Regulation and Age at Onset of Hypertension: A SAPPHIRe Cohort Study.Medicine (Baltimore). 2016 Mar;95(10):e2970. doi: 10.1097/MD.0000000000002970.
• [18] Indexing disease progression at study entry with individuals at-risk for Huntington disease.Am J Med Genet B Neuropsychiatr Genet. 2011 Dec;156B(7):751-63. doi: 10.1002/ajmg.b.31232. Epub 2011 Aug 19.
• [19] Frontline bortezomib, rituximab, cyclophosphamide, doxorubicin, and prednisone (VR-CAP) versus rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone (R-CHOP) in transplantation-ineligible patients with newly diagnosed mantle cell lymphoma: final overall survival results of a randomised, open-label, phase 3 study.Lancet Oncol. 2018 Nov;19(11):1449-1458. doi: 10.1016/S1470-2045(18)30685-5. Epub 2018 Oct 19.
• [20] Assessing the impact of the 2018 American Society of Clinical Oncology/College of American Pathologists recommendations on human epidermal growth factor receptor 2 testing by fluorescence in situ hybridization in breast carcinoma.Virchows Arch. 2020 Mar;476(3):367-372. doi: 10.1007/s00428-019-02636-3. Epub 2019 Aug 3.
• [21] Optimal threshold of controlled attenuation parameter with MRI-PDFF as the gold standard for the detection of hepatic steatosis.Hepatology. 2018 Apr;67(4):1348-1359. doi: 10.1002/hep.29639. Epub 2018 Feb 19.
• [22] Capsaicin reduces Alzheimer-associated tau changes in the hippocampus of type 2 diabetes rats.PLoS One. 2017 Feb 22;12(2):e0172477. doi: 10.1371/journal.pone.0172477. eCollection 2017.
• [23] Disease-associated mutations in the p150(Glued) subunit destabilize the CAP-gly domain.Biochemistry. 2010 Jun 29;49(25):5083-5. doi: 10.1021/bi100235z.
• [24] A case-control study of community-acquired Acinetobacter baumannii pneumonia and melioidosis pneumonia in northeast Thailand: an emerging fatal disease with unique clinical features.Diagn Microbiol Infect Dis. 2017 Jan;87(1):79-86. doi: 10.1016/j.diagmicrobio.2016.10.014. Epub 2016 Oct 11.
• [25] Urinary biomarkers in prostate cancer detection and monitoring progression.Crit Rev Oncol Hematol. 2017 Oct;118:15-26. doi: 10.1016/j.critrevonc.2017.08.002. Epub 2017 Aug 19.
• [26] Comparative RNA-seq analysis reveals dys-regulation of major canonical pathways in ERG-inducible LNCaP cell progression model of prostate cancer.Oncotarget. 2019 Jul 2;10(42):4290-4306. doi: 10.18632/oncotarget.27019. eCollection 2019 Jul 2.
• [27] Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.Eur Arch Psychiatry Clin Neurosci. 2009 Apr;259(3):151-63. doi: 10.1007/s00406-008-0847-2. Epub 2009 Jan 22.
• [28] Borderline hemoglobin A(2) levels in northern Thai population: HBB genotypes and effects of coinherited alpha-thalassemia.Blood Cells Mol Dis. 2019 Feb;74:13-17. doi: 10.1016/j.bcmd.2018.10.002. Epub 2018 Oct 4.
• [29] A Novel Micro Cold Atmospheric Plasma Device for Glioblastoma Both In Vitro and In Vivo.Cancers (Basel). 2017 May 30;9(6):61. doi: 10.3390/cancers9060061.
• [30] DMO-CAP inhibits influenza virus replication by activating heme oxygenase-1-mediated IFN response.Virol J. 2019 Feb 20;16(1):21. doi: 10.1186/s12985-019-1125-9.
• [31] Assessment of dual-probe Her-2 fluorescent in situ hybridization in breast cancer by the 2013 ASCO/CAP guidelines produces more equivocal results than that by the 2007 ASCO/CAP guidelines.Breast Cancer Res Treat. 2016 Aug;159(1):31-9. doi: 10.1007/s10549-016-3917-6. Epub 2016 Jul 25.
• [32] Healthcare- and Community-Associated Methicillin-Resistant Staphylococcus aureus (MRSA) and Fatal Pneumonia with Pediatric Deaths in Krasnoyarsk, Siberian Russia: Unique MRSA's Multiple Virulence Factors, Genome, and Stepwise Evolution.PLoS One. 2015 Jun 5;10(6):e0128017. doi: 10.1371/journal.pone.0128017. eCollection 2015.
• [33] A new genetic polymorphism in the 16S ribosomal RNA gene of human mitochondrial DNA.Ann Hum Genet. 1989 Oct;53(4):303-10. doi: 10.1111/j.1469-1809.1989.tb01799.x.
• [34] Assessing the HER2 status in mucinous epithelial ovarian cancer on the basis of the 2013 ASCO/CAP guideline update.Am J Surg Pathol. 2014 Sep;38(9):1227-34. doi: 10.1097/PAS.0000000000000268.
• [35] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [36] Pseudotyped adeno-associated virus 2/9-delivered CCL11 shRNA alleviates lung inflammation in an allergen-sensitized mouse model.Hum Gene Ther. 2012 Nov;23(11):1156-65. doi: 10.1089/hum.2012.012. Epub 2012 Oct 19.
• [37] Inhibition of STAT3 blocks protein synthesis and tumor metastasis in osteosarcoma cells.J Exp Clin Cancer Res. 2018 Oct 4;37(1):244. doi: 10.1186/s13046-018-0914-0.
• [38] A novel scoring system for gastric cancer risk assessment based on the expression of three CLIP4 DNA methylation-associated genes.Int J Oncol. 2018 Aug;53(2):633-643. doi: 10.3892/ijo.2018.4433. Epub 2018 Jun 6.
• [39] SORBS1 suppresses tumor metastasis and improves the sensitivity of cancer to chemotherapy drug.Oncotarget. 2017 Feb 7;8(6):9108-9122. doi: 10.18632/oncotarget.12851.
• [40] Genomics of post-prandial lipidomic phenotypes in the Genetics of Lipid lowering Drugs and Diet Network (GOLDN) study.PLoS One. 2014 Jun 6;9(6):e99509. doi: 10.1371/journal.pone.0099509. eCollection 2014.
• [41] Long-Term Safety and Efficacy in Continued Access Left Atrial Appendage Closure Registries.J Am Coll Cardiol. 2019 Dec 10;74(23):2878-2889. doi: 10.1016/j.jacc.2019.09.064.
• [42] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [43] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [44] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [45] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [46] Epigenetic changes in individuals with arsenicosis. Chem Res Toxicol. 2011 Feb 18;24(2):165-7. doi: 10.1021/tx1004419. Epub 2011 Feb 4.
• [47] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [48] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [49] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [50] Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
• [51] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [52] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [53] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [54] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [55] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [56] Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
• [57] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [58] The molecular basis of genistein-induced mitotic arrest and exit of self-renewal in embryonal carcinoma and primary cancer cell lines. BMC Med Genomics. 2008 Oct 10;1:49.
• [59] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [60] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [61] Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.
• [62] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [63] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [64] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [65] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
• [66] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.