Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXET551)

• DOT Name: Thrombospondin-2 (THBS2)
• Gene Name: THBS2
• Related Disease:
  Melanoma
  Pancreatic cancer
  Type-1 diabetes
  Asthma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cardiac disease
  Cervical cancer
  Cervical carcinoma
  Colon cancer
  Colon carcinoma
  Endometrial cancer
  Endometrial carcinoma
  Glioma
  Hepatocellular carcinoma
  Intervertebral disc degeneration
  Invasive breast carcinoma
  Lung adenocarcinoma
  Matthew-Wood syndrome
  Non-small-cell lung cancer
  Obesity
  Ovarian neoplasm
  Plasma cell myeloma
  Schistosomiasis
  Triple negative breast cancer
  Type-1/2 diabetes
  Bladder cancer
  Epithelial ovarian cancer
  Gastric cancer
  Intracerebral hemorrhage
  Metastatic malignant neoplasm
  Ovarian cancer
  Prostate cancer
  Prostate carcinoma
  Stomach cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Adenocarcinoma
  Carcinoma
  Advanced cancer
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Myocardial infarction
  Neuroblastoma
  Non-insulin dependent diabetes
  Pancreatic ductal carcinoma
  Squamous cell carcinoma
• UniProt ID: TSP2_HUMAN
• PDB ID: 1YO8; 2RHP
• Pfam ID: PF12947 ; PF00090 ; PF02412 ; PF05735 ; PF00093
• Sequence:
  MVWRLVLLALWVWPSTQAGHQDKDTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
  DYIPPVNADDLSKITKIMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGP
  ADTLDLTYWIDGTRHVVSLEDVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFY
  EHLQAEKSRMYVAKGSARESHFRGLLQNVHLVFENSVEDILSKKGCQQGQGAEINAISEN
  TETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKRVSND
  NQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTICHQITCPPATC
  ASPSFVEGECCPSCLHSVDGEEGWSPWAEWTQCSVTCGSGTQQRGRSCDVTSNTCLGPSI
  QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
  RETKACQGAPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQER
  QMCNKRSCPVDGCLSNPCFPGAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECALVPDI
  CFSTSKVPRCVNTQPGFHCLPCPPRYRGNQPVGVGLEAAKTEKQVCEPENPCKDKTHNCH
  KHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNC
  PHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCP
  YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
  VHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDD
  DNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFR
  NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
  DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRN
  ALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPI
  YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDI
• Function: Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties.
• Tissue Specificity: High expression in invertebral disk tissue.
• KEGG Pathway:
  Phagosome (hsa04145)
  PI3K-Akt sig.ling pathway (hsa04151)
  Focal adhesion (hsa04510)
  ECM-receptor interaction (hsa04512)
  Cytoskeleton in muscle cells (hsa04820)
  Malaria (hsa05144)
  Human papillomavirus infection (hsa05165)
• Reactome Pathway:
  Defective B3GALTL causes PpS (R-HSA-5083635)
  O-glycosylation of TSR domain-containing proteins (R-HSA-5173214)
  Signaling by PDGF (R-HSA-186797)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Melanoma	DIS1RRCY	Definitive	Biomarker	[1]
Pancreatic cancer	DISJC981	Definitive	Biomarker	[2]
Type-1 diabetes	DIS7HLUB	Definitive	Genetic Variation	[3]
Asthma	DISW9QNS	Strong	Biomarker	[4]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[5]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[5]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[6]
Cardiac disease	DISVO1I5	Strong	Biomarker	[7]
Cervical cancer	DISFSHPF	Strong	Biomarker	[8]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[8]
Colon cancer	DISVC52G	Strong	Biomarker	[9]
Colon carcinoma	DISJYKUO	Strong	Genetic Variation	[10]
Endometrial cancer	DISW0LMR	Strong	Altered Expression	[11]
Endometrial carcinoma	DISXR5CY	Strong	Altered Expression	[11]
Glioma	DIS5RPEH	Strong	Altered Expression	[12]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[13]
Intervertebral disc degeneration	DISG3AIM	Strong	Biomarker	[14]
Invasive breast carcinoma	DISANYTW	Strong	Biomarker	[15]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[16]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[17]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[18]
Obesity	DIS47Y1K	Strong	Biomarker	[19]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[20]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[21]
Schistosomiasis	DIS6PD44	Strong	Biomarker	[22]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[5]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[19]
Bladder cancer	DISUHNM0	moderate	Biomarker	[23]
Epithelial ovarian cancer	DIS56MH2	moderate	Altered Expression	[20]
Gastric cancer	DISXGOUK	moderate	Biomarker	[24]
Intracerebral hemorrhage	DISC81BT	moderate	Biomarker	[25]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[26]
Ovarian cancer	DISZJHAP	moderate	Altered Expression	[20]
Prostate cancer	DISF190Y	moderate	Biomarker	[27]
Prostate carcinoma	DISMJPLE	moderate	Biomarker	[27]
Stomach cancer	DISKIJSX	moderate	Biomarker	[24]
Urinary bladder cancer	DISDV4T7	moderate	Biomarker	[23]
Urinary bladder neoplasm	DIS7HACE	moderate	Biomarker	[23]
Adenocarcinoma	DIS3IHTY	Disputed	Biomarker	[28]
Carcinoma	DISH9F1N	Disputed	Altered Expression	[28]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[29]
Lung cancer	DISCM4YA	Limited	Biomarker	[29]
Lung carcinoma	DISTR26C	Limited	Biomarker	[29]
Lung neoplasm	DISVARNB	Limited	Altered Expression	[26]
Myocardial infarction	DIS655KI	Limited	Genetic Variation	[30]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[31]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[32]
Pancreatic ductal carcinoma	DIS26F9Q	Limited	Biomarker	[2]
Squamous cell carcinoma	DISQVIFL	Limited	Altered Expression	[16]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Thrombospondin-2 (THBS2).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Thrombospondin-2 (THBS2).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Thrombospondin-2 (THBS2).	[51]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Thrombospondin-2 (THBS2).	[34]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Thrombospondin-2 (THBS2).	[35]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Thrombospondin-2 (THBS2).	[36]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Thrombospondin-2 (THBS2).	[37]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Thrombospondin-2 (THBS2).	[38]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Thrombospondin-2 (THBS2).	[39]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Thrombospondin-2 (THBS2).	[40]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Thrombospondin-2 (THBS2).	[41]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Thrombospondin-2 (THBS2).	[34]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Thrombospondin-2 (THBS2).	[42]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Thrombospondin-2 (THBS2).	[43]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Thrombospondin-2 (THBS2).	[36]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Thrombospondin-2 (THBS2).	[44]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Thrombospondin-2 (THBS2).	[45]
Piroxicam	DMTK234	Approved	Piroxicam increases the expression of Thrombospondin-2 (THBS2).	[45]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Thrombospondin-2 (THBS2).	[46]
Permethrin	DMZ0Q1G	Approved	Permethrin decreases the expression of Thrombospondin-2 (THBS2).	[47]
Ifosfamide	DMCT3I8	Approved	Ifosfamide decreases the expression of Thrombospondin-2 (THBS2).	[48]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Thrombospondin-2 (THBS2).	[43]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene decreases the expression of Thrombospondin-2 (THBS2).	[36]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Thrombospondin-2 (THBS2).	[50]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Thrombospondin-2 (THBS2).	[52]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Thrombospondin-2 (THBS2).	[53]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone decreases the expression of Thrombospondin-2 (THBS2).	[54]
I-BET151	DMYRUH2	Investigative	I-BET151 decreases the expression of Thrombospondin-2 (THBS2).	[50]
PFI-1	DMVFK3J	Investigative	PFI-1 decreases the expression of Thrombospondin-2 (THBS2).	[50]

References

• [1] The Construction and Comprehensive Analysis of ceRNA Networks and Tumor-Infiltrating Immune Cells in Bone Metastatic Melanoma.Front Genet. 2019 Sep 25;10:828. doi: 10.3389/fgene.2019.00828. eCollection 2019.
• [2] Thrombospondin-2 is a Highly Specific Diagnostic Marker and is Associated with Prognosis in Pancreatic Cancer.Ann Surg Oncol. 2019 Mar;26(3):807-814. doi: 10.1245/s10434-018-07109-6. Epub 2018 Dec 19.
• [3] Association analysis between thrombospondin-2 gene polymorphisms and intervertebral disc degeneration in a Chinese Han population.Medicine (Baltimore). 2018 Jan;97(2):e9586. doi: 10.1097/MD.0000000000009586.
• [4] Therapeutic Role for TSP-2 Antibody in a Murine Asthma Model.Int Arch Allergy Immunol. 2018;175(3):160-170. doi: 10.1159/000486313. Epub 2018 Jan 27.
• [5] Class I histone deacetylase inhibitor suppresses vasculogenic mimicry by enhancing the expression of tumor suppressor and anti-angiogenesis genes in aggressive human TNBC cells.Int J Oncol. 2019 Jul;55(1):116-130. doi: 10.3892/ijo.2019.4796. Epub 2019 May 6.
• [6] Genetic and epigenetic alterations in sentinel lymph nodes metastatic lesions compared to their corresponding primary breast tumors.Cancer Genet Cytogenet. 2003 Oct 1;146(1):33-40. doi: 10.1016/s0165-4608(03)00123-7.
• [7] Thrombospondin-2 as a Potential Risk Factor in a General Population.Int Heart J. 2019 Mar 20;60(2):310-317. doi: 10.1536/ihj.18-246. Epub 2019 Feb 8.
• [8] MicroRNA-20a regulates cell proliferation, apoptosis and autophagy by targeting thrombospondin 2 in cervical cancer.Eur J Pharmacol. 2019 Feb 5;844:102-109. doi: 10.1016/j.ejphar.2018.11.043. Epub 2018 Dec 1.
• [9] Human thrombospondin 2 inhibits proliferation of microvascular endothelial cells.Int J Oncol. 2002 Feb;20(2):339-42.
• [10] Overexpression of the thrombospondin 2 (TSP2) gene modulated by the matrix metalloproteinase family expression and production in human colon carcinoma cell line.Oncol Rep. 2003 Jul-Aug;10(4):881-4.
• [11] Thrombospondin-1 and -2 messenger RNA expression in normal and neoplastic endometrial tissues: correlation with angiogenesis and prognosis.Int J Oncol. 2001 Aug;19(2):305-10. doi: 10.3892/ijo.19.2.305.
• [12] Correlation of thrombospondin-1 and transforming growth factor-beta expression with malignancy of glioma.Neuropathology. 2000 Sep;20(3):161-9. doi: 10.1046/j.1440-1789.2000.00327.x.
• [13] CircRNA has_circ_0078710 acts as the sponge of microRNA-31 involved in hepatocellular carcinoma progression.Gene. 2019 Jan 30;683:253-261. doi: 10.1016/j.gene.2018.10.043. Epub 2018 Oct 17.
• [14] A population-based study identifies an association of THBS2 with intervertebral disc degeneration.Osteoarthritis Cartilage. 2019 Oct;27(10):1501-1507. doi: 10.1016/j.joca.2019.06.001. Epub 2019 Jun 21.
• [15] Targeted matrisome analysis identifies thrombospondin-2 and tenascin-C in aligned collagen stroma from invasive breast carcinoma.Sci Rep. 2018 Aug 28;8(1):12941. doi: 10.1038/s41598-018-31126-w.
• [16] Differential Expression Pattern of THBS1 and THBS2 in Lung Cancer: Clinical Outcome and a Systematic-Analysis of Microarray Databases.PLoS One. 2016 Aug 11;11(8):e0161007. doi: 10.1371/journal.pone.0161007. eCollection 2016.
• [17] A Blood-Based Multi Marker Assay Supports the Differential Diagnosis of Early-Stage Pancreatic Cancer.Theranostics. 2019 Feb 12;9(5):1280-1287. doi: 10.7150/thno.29247. eCollection 2019.
• [18] Serum thrombospondin-2 is a candidate diagnosis biomarker for early non-small-cell lung cancer.Biosci Rep. 2019 Jul 25;39(7):BSR20190476. doi: 10.1042/BSR20190476. Print 2019 Jul 31.
• [19] Elevated Thrombospondin 2 Contributes to Delayed Wound Healing in Diabetes.Diabetes. 2019 Oct;68(10):2016-2023. doi: 10.2337/db18-1001. Epub 2019 Aug 7.
• [20] Microvessel density and CpG island methylation of the THBS2 gene in malignant ovarian tumors.J Physiol Pharmacol. 2008 Sep;59 Suppl 4:53-65.
• [21] Dysregulation of CD47 and the ligands thrombospondin 1 and 2 in multiple myeloma.Br J Haematol. 2007 Sep;138(6):756-60. doi: 10.1111/j.1365-2141.2007.06729.x.
• [22] Enhanced protective efficacy of a chimeric form of the schistosomiasis vaccine antigen Sm-TSP-2.PLoS Negl Trop Dis. 2012;6(3):e1564. doi: 10.1371/journal.pntd.0001564. Epub 2012 Mar 13.
• [23] The Pathological Significance and Prognostic Roles of Thrombospondin-1, and -2, and 4N1K-peptide in Bladder Cancer.Anticancer Res. 2019 May;39(5):2317-2324. doi: 10.21873/anticanres.13348.
• [24] Identification of significant biomarkers and pathways associated with gastric carcinogenesis by whole genome-wide expression profiling analysis.Int J Oncol. 2018 Mar;52(3):955-966. doi: 10.3892/ijo.2018.4243. Epub 2018 Jan 11.
• [25] Alteration of thrombospondin-1 and -2 in rat brains following experimental intracerebral hemorrhage. Laboratory investigation.J Neurosurg. 2010 Oct;113(4):820-5. doi: 10.3171/2010.1.JNS09637.
• [26] Thrombospondin 2 promotes tumor metastasis by inducing matrix metalloproteinase-13 production in lung cancer cells.Biochem Pharmacol. 2018 Sep;155:537-546. doi: 10.1016/j.bcp.2018.07.024. Epub 2018 Jul 20.
• [27] Thrombospondin-2 promotes prostate cancer bone metastasis by the up-regulation of matrix metalloproteinase-2 through down-regulating miR-376c expression.J Hematol Oncol. 2017 Jan 25;10(1):33. doi: 10.1186/s13045-017-0390-6.
• [28] Cancerous, but not stromal, thrombospondin-2 contributes prognosis in pulmonary adenocarcinoma.Oncol Rep. 2009 Aug;22(2):279-83.
• [29] Thrombospondin enhances RANKL-dependent osteoclastogenesis and facilitates lung cancer bone metastasis.Biochem Pharmacol. 2019 Aug;166:23-32. doi: 10.1016/j.bcp.2019.05.005. Epub 2019 May 7.
• [30] Increased coagulation factor XIII activity but not genetic variants of coagulation factors is associated with myocardial infarction in young patients.J Thromb Thrombolysis. 2019 Oct;48(3):519-527. doi: 10.1007/s11239-019-01856-3.
• [31] A Promyelocytic Leukemia Protein-Thrombospondin-2 Axis and the Risk of Relapse in Neuroblastoma.Clin Cancer Res. 2016 Jul 1;22(13):3398-409. doi: 10.1158/1078-0432.CCR-15-2081. Epub 2016 Apr 13.
• [32] Gender differences in the association of gene polymorphisms with type 2 diabetes mellitus.Int J Mol Med. 2007 Apr;19(4):631-7.
• [33] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [34] Primary Human Hepatocyte Spheroids as Tools to Study the Hepatotoxic Potential of Non-Pharmaceutical Chemicals. Int J Mol Sci. 2021 Oct 12;22(20):11005. doi: 10.3390/ijms222011005.
• [35] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [36] Comparative gene expression profiling reveals partially overlapping but distinct genomic actions of different antiestrogens in human breast cancer cells. J Cell Biochem. 2006 Aug 1;98(5):1163-84.
• [37] Integrated assessment by multiple gene expression analysis of quercetin bioactivity on anticancer-related mechanisms in colon cancer cells in vitro. Eur J Nutr. 2005 Mar;44(3):143-56. doi: 10.1007/s00394-004-0503-1. Epub 2004 Apr 30.
• [38] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [39] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [40] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [41] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [42] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [43] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [44] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [45] Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
• [46] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [47] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [48] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [49] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [50] BRD4 is a novel therapeutic target for liver fibrosis. Proc Natl Acad Sci U S A. 2015 Dec 22;112(51):15713-8. doi: 10.1073/pnas.1522163112. Epub 2015 Dec 7.
• [51] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [52] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [53] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [54] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.