Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ3BEC4)

• DOT Name: Peroxiredoxin-1 (PRDX1)
• Synonyms: EC 1.11.1.24; Natural killer cell-enhancing factor A; NKEF-A; Proliferation-associated gene protein; PAG; Thioredoxin peroxidase 2; Thioredoxin-dependent peroxide reductase 2; Thioredoxin-dependent peroxiredoxin 1
• Gene Name: PRDX1
• Related Disease:
  Parkinson disease
  Adenocarcinoma
  Adult glioblastoma
  Advanced cancer
  Alzheimer disease
  Arteriosclerosis
  Asbestosis
  Atherosclerosis
  Breast cancer
  Breast carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Glioma
  Hepatocellular carcinoma
  Keloid
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Methylmalonic aciduria and homocystinuria type cblC
  Neoplasm
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
  Precancerous condition
  Squamous cell carcinoma
  Bone osteosarcoma
  Clear cell renal carcinoma
  Glioblastoma multiforme
  Metastatic malignant neoplasm
  Osteoarthritis
  Osteosarcoma
  Renal cell carcinoma
  Prostate cancer
  Prostate carcinoma
  Carcinoma
  Gastric cancer
  Liver cancer
  Lung neoplasm
  Neuroblastoma
  Non-insulin dependent diabetes
  Pancreatic cancer
  Plasma cell myeloma
  Schistosomiasis
  Stomach cancer
  Type-1/2 diabetes
• UniProt ID: PRDX1_HUMAN
• PDB ID: 2RII; 3HY2; 4XCS; 7LJ1; 7WET; 7WEU
• EC Number: 1.11.1.24
• Pfam ID: PF10417 ; PF00578
• Sequence:
  MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFS
  DRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK
  ADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPG
  SDTIKPDVQKSKEYFSKQK
• Function: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation.
• KEGG Pathway:
  Peroxisome (hsa04146)
  Cobalamin transport and metabolism (hsa04980)
  Amoebiasis (hsa05146)
• Reactome Pathway:
  TP53 Regulates Metabolic Genes (R-HSA-5628897)
  Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models (R-HSA-8862803)
  NFE2L2 regulating anti-oxidant/detoxification enzymes (R-HSA-9818027)
  Detoxification of Reactive Oxygen Species (R-HSA-3299685)
• BioCyc Pathway: MetaCyc:HS04134-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Parkinson disease	DISQVHKL	Definitive	Altered Expression	[1]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[2]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Biomarker	[5]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[6]
Asbestosis	DISO5XCZ	Strong	Biomarker	[7]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[8]
Colon cancer	DISVC52G	Strong	Altered Expression	[9]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[10]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[11]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[12]
Glioma	DIS5RPEH	Strong	Altered Expression	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[14]
Keloid	DISV09JY	Strong	Biomarker	[15]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[16]
Lung cancer	DISCM4YA	Strong	Biomarker	[11]
Lung carcinoma	DISTR26C	Strong	Biomarker	[17]
Methylmalonic aciduria and homocystinuria type cblC	DISUDX17	Strong	Autosomal recessive	[18]
Neoplasm	DISZKGEW	Strong	Biomarker	[19]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[20]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[11]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[11]
Precancerous condition	DISV06FL	Strong	Biomarker	[21]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[22]
Bone osteosarcoma	DIST1004	moderate	Altered Expression	[23]
Clear cell renal carcinoma	DISBXRFJ	moderate	Biomarker	[24]
Glioblastoma multiforme	DISK8246	moderate	Posttranslational Modification	[13]
Metastatic malignant neoplasm	DIS86UK6	moderate	Altered Expression	[23]
Osteoarthritis	DIS05URM	moderate	Genetic Variation	[25]
Osteosarcoma	DISLQ7E2	moderate	Altered Expression	[23]
Renal cell carcinoma	DISQZ2X8	moderate	Biomarker	[24]
Prostate cancer	DISF190Y	Disputed	Biomarker	[19]
Prostate carcinoma	DISMJPLE	Disputed	Biomarker	[19]
Carcinoma	DISH9F1N	Limited	Altered Expression	[26]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[27]
Liver cancer	DISDE4BI	Limited	Altered Expression	[28]
Lung neoplasm	DISVARNB	Limited	Biomarker	[7]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[29]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Altered Expression	[30]
Pancreatic cancer	DISJC981	Limited	Biomarker	[31]
Plasma cell myeloma	DIS0DFZ0	Limited	Altered Expression	[32]
Schistosomiasis	DIS6PD44	Limited	Therapeutic	[33]
Stomach cancer	DISKIJSX	Limited	Altered Expression	[27]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[34]

30 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Peroxiredoxin-1 (PRDX1).	[35]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Peroxiredoxin-1 (PRDX1).	[36]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Peroxiredoxin-1 (PRDX1).	[37]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Peroxiredoxin-1 (PRDX1).	[38]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Peroxiredoxin-1 (PRDX1).	[39]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Peroxiredoxin-1 (PRDX1).	[40]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Peroxiredoxin-1 (PRDX1).	[41]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Peroxiredoxin-1 (PRDX1).	[42]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Peroxiredoxin-1 (PRDX1).	[43]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Peroxiredoxin-1 (PRDX1).	[44]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Peroxiredoxin-1 (PRDX1).	[36]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Peroxiredoxin-1 (PRDX1).	[45]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Peroxiredoxin-1 (PRDX1).	[46]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Peroxiredoxin-1 (PRDX1).	[47]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Peroxiredoxin-1 (PRDX1).	[48]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Peroxiredoxin-1 (PRDX1).	[49]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Peroxiredoxin-1 (PRDX1).	[50]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Peroxiredoxin-1 (PRDX1).	[51]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Peroxiredoxin-1 (PRDX1).	[52]
Etretinate	DM2CZFA	Approved	Etretinate decreases the expression of Peroxiredoxin-1 (PRDX1).	[54]
I3C	DMIGFOR	Phase 3	I3C decreases the expression of Peroxiredoxin-1 (PRDX1).	[56]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone decreases the expression of Peroxiredoxin-1 (PRDX1).	[57]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Peroxiredoxin-1 (PRDX1).	[60]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Peroxiredoxin-1 (PRDX1).	[61]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Peroxiredoxin-1 (PRDX1).	[62]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Peroxiredoxin-1 (PRDX1).	[64]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Peroxiredoxin-1 (PRDX1).	[65]
D-glucose	DMMG2TO	Investigative	D-glucose increases the expression of Peroxiredoxin-1 (PRDX1).	[66]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone affects the splicing of Peroxiredoxin-1 (PRDX1).	[67]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid decreases the expression of Peroxiredoxin-1 (PRDX1).	[69]

3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin affects the binding of Peroxiredoxin-1 (PRDX1).	[53]
Resveratrol	DM3RWXL	Phase 3	Resveratrol affects the secretion of Peroxiredoxin-1 (PRDX1).	[55]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal affects the binding of Peroxiredoxin-1 (PRDX1).	[68]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
DNCB	DMDTVYC	Phase 2	DNCB affects the oxidation of Peroxiredoxin-1 (PRDX1).	[58]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Peroxiredoxin-1 (PRDX1).	[59]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the methylation of Peroxiredoxin-1 (PRDX1).	[63]
acrolein	DMAMCSR	Investigative	acrolein increases the oxidation of Peroxiredoxin-1 (PRDX1).	[70]

References

• [1] Inhibition of HDAC6 increases acetylation of peroxiredoxin1/2 and ameliorates 6-OHDA induced dopaminergic injury.Neurosci Lett. 2017 Sep 29;658:114-120. doi: 10.1016/j.neulet.2017.08.029. Epub 2017 Aug 18.
• [2] Nrf2-peroxiredoxin I axis in polymorphous adenocarcinoma is associated with low matrix metalloproteinase 2 level.Virchows Arch. 2017 Dec;471(6):793-798. doi: 10.1007/s00428-017-2218-8. Epub 2017 Aug 28.
• [3] Identification of the Gene Expression Rules That Define the Subtypes in Glioma.J Clin Med. 2018 Oct 13;7(10):350. doi: 10.3390/jcm7100350.
• [4] Frenolicin B Targets Peroxiredoxin 1 and Glutaredoxin 3 to Trigger ROS/4E-BP1-Mediated Antitumor Effects. Cell Chem Biol. 2019 Mar 21;26(3):366-377.e12. doi: 10.1016/j.chembiol.2018.11.013. Epub 2019 Jan 17.
• [5] Oxidative Stress and Decreased Mitochondrial Superoxide Dismutase 2 and Peroxiredoxins 1 and 4 Based Mechanism of Concurrent Activation of AMPK and mTOR in Alzheimer's Disease.Curr Alzheimer Res. 2018;15(8):764-776. doi: 10.2174/1567205015666180223093020.
• [6] Prdx1 (peroxiredoxin 1) deficiency reduces cholesterol efflux via impaired macrophage lipophagic flux.Autophagy. 2018;14(1):120-133. doi: 10.1080/15548627.2017.1327942. Epub 2017 Nov 25.
• [7] Peroxiredoxins and tropomyosins as plasma biomarkers for lung cancer and asbestos exposure.Lung Cancer. 2012 Aug;77(2):450-9. doi: 10.1016/j.lungcan.2012.03.024. Epub 2012 Apr 24.
• [8] The peroxidase PRDX1 inhibits the activated phenotype in mammary fibroblasts through regulating c-Jun N-terminal kinases.BMC Cancer. 2019 Aug 16;19(1):812. doi: 10.1186/s12885-019-6031-4.
• [9] Induction of radioprotective peroxiredoxin-I by ionizing irradiation.J Neurosci Res. 2002 Dec 15;70(6):794-8. doi: 10.1002/jnr.10435.
• [10] Peroxiredoxin 1 promoted tumor metastasis and angiogenesis in colorectal cancer.Pathol Res Pract. 2018 May;214(5):655-660. doi: 10.1016/j.prp.2018.03.026. Epub 2018 Apr 3.
• [11] Peroxiredoxin-1 as a prognostic factor in patients with ovarian cancer.Ann Agric Environ Med. 2019 Sep 19;26(3):415-419. doi: 10.26444/aaem/105899. Epub 2019 Apr 1.
• [12] Peroxiredoxin 1 is a tumor-associated antigen in esophageal squamous cell carcinoma.Oncol Rep. 2013 Nov;30(5):2297-303. doi: 10.3892/or.2013.2714. Epub 2013 Sep 4.
• [13] A PRDX1-p38 heterodimer amplifies MET-driven invasion of IDH-wildtype and IDH-mutant gliomas.Int J Cancer. 2018 Sep 1;143(5):1176-1187. doi: 10.1002/ijc.31404. Epub 2018 Apr 16.
• [14] Peroxiredoxin 1, restraining cell migration and invasion, is involved in hepatocellular carcinoma recurrence.J Dig Dis. 2018 Mar;19(3):155-169. doi: 10.1111/1751-2980.12580.
• [15] Comparative proteomic analysis between normal skin and keloid scar.Br J Dermatol. 2010 Jun;162(6):1302-15. doi: 10.1111/j.1365-2133.2010.09660.x. Epub 2010 Feb 1.
• [16] Downregulation of peroxiredoxin-1 by -elemene enhances the radiosensitivity of lung adenocarcinoma xenografts.Oncol Rep. 2015 Mar;33(3):1427-33. doi: 10.3892/or.2015.3732. Epub 2015 Jan 19.
• [17] Prx1 modulates the chemosensitivity of lung cancer to docetaxel through suppression of FOXO1-induced apoptosis.Int J Oncol. 2013 Jul;43(1):72-8. doi: 10.3892/ijo.2013.1918. Epub 2013 Apr 24.
• [18] APRDX1 mutant allele causes a MMACHC secondary epimutation in cblC patients. Nat Commun. 2018 Jan 4;9(1):67. doi: 10.1038/s41467-017-02306-5.
• [19] TXNDC9 regulates oxidative stress-induced androgen receptor signaling to promote prostate cancer progression.Oncogene. 2020 Jan;39(2):356-367. doi: 10.1038/s41388-019-0991-3. Epub 2019 Sep 2.
• [20] Up-regulation of peroxiredoxin 1 in lung cancer and its implication as a prognostic and therapeutic target.Clin Cancer Res. 2008 Apr 15;14(8):2326-33. doi: 10.1158/1078-0432.CCR-07-4457.
• [21] Comparative proteomic analysis of esophageal squamous cell carcinoma.Proteomics. 2005 Jul;5(11):2960-71. doi: 10.1002/pmic.200401175.
• [22] Identification of RAB2A and PRDX1 as the potential biomarkers for oral squamous cell carcinoma using mass spectrometry-based comparative proteomic approach.Tumour Biol. 2015 Dec;36(12):9829-37. doi: 10.1007/s13277-015-3758-7. Epub 2015 Jul 11.
• [23] Peroxiredoxin-1 promotes cell proliferation and metastasis through enhancing Akt/mTOR in human osteosarcoma cells.Oncotarget. 2017 Dec 23;9(9):8290-8302. doi: 10.18632/oncotarget.23662. eCollection 2018 Feb 2.
• [24] Exploring the Natural Piericidins as Anti-Renal Cell Carcinoma Agents Targeting Peroxiredoxin 1.J Med Chem. 2019 Aug 8;62(15):7058-7069. doi: 10.1021/acs.jmedchem.9b00598. Epub 2019 Jul 25.
• [25] Regulation of Chondrocyte Survival in Mouse Articular Cartilage by p63.Arthritis Rheumatol. 2017 Mar;69(3):598-609. doi: 10.1002/art.39976.
• [26] PRDX1 and PRDX6 are repressed in papillary thyroid carcinomas via BRAF V600E-dependent and -independent mechanisms.Int J Oncol. 2014 Feb;44(2):548-56. doi: 10.3892/ijo.2013.2208. Epub 2013 Dec 5.
• [27] MicroRNA-596 acts as a tumor suppressor in gastric cancer and is upregulated by promotor demethylation.World J Gastroenterol. 2019 Mar 14;25(10):1224-1237. doi: 10.3748/wjg.v25.i10.1224.
• [28] Aberrant expression of peroxiredoxin 1 and its clinical implications in liver cancer.World J Gastroenterol. 2015 Oct 14;21(38):10840-52. doi: 10.3748/wjg.v21.i38.10840.
• [29] The novel cholinesterase-monoamine oxidase inhibitor and antioxidant, ladostigil, confers neuroprotection in neuroblastoma cells and aged rats.J Mol Neurosci. 2009 Feb;37(2):135-45. doi: 10.1007/s12031-008-9139-6. Epub 2008 Aug 27.
• [30] PRDX1 is involved in palmitate induced insulin resistance via regulating the activity of p38MAPK in HepG2 cells.Biochem Biophys Res Commun. 2015 Oct 2;465(4):670-7. doi: 10.1016/j.bbrc.2015.08.008. Epub 2015 Aug 21.
• [31] Peroxiredoxin 1 silencing inhibited the growth and promoted apoptosis of pancreatic cancer cells via targeting FOXO3 gene.Cancer Manag Res. 2018 Oct 26;10:5019-5026. doi: 10.2147/CMAR.S177243. eCollection 2018.
• [32] 15d-PGJ(2) as an endoplasmic reticulum stress manipulator in multiple myeloma in vitro and in vivo.Exp Mol Pathol. 2017 Jun;102(3):434-445. doi: 10.1016/j.yexmp.2017.05.003. Epub 2017 May 12.
• [33] Peroxiredoxin-1 from Schistosoma japonicum functions as a scavenger against hydrogen peroxide but not nitric oxide.Mol Biochem Parasitol. 2009 Mar;164(1):26-31. doi: 10.1016/j.molbiopara.2008.11.002. Epub 2008 Nov 12.
• [34] Effects of hydrogen sulfide on inducible nitric oxide synthase activity and expression of cardiomyocytes in diabetic rats.Mol Med Rep. 2017 Oct;16(4):5277-5284. doi: 10.3892/mmr.2017.7247. Epub 2017 Aug 14.
• [35] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [36] Comparison of the gene expression profiles of monocytic versus granulocytic lineages of HL-60 leukemia cell differentiation by DNA microarray analysis. Life Sci. 2003 Aug 15;73(13):1705-19. doi: 10.1016/s0024-3205(03)00515-0.
• [37] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [38] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [39] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [40] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [41] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [42] Genome-wide analysis of BEAS-2B cells exposed to trivalent arsenicals and dimethylthioarsinic acid. Toxicology. 2010 Jan 31;268(1-2):31-9.
• [43] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [44] The neuroprotective effect of ladostigil against hydrogen peroxide-mediated cytotoxicity. Chem Biol Interact. 2008 Sep 25;175(1-3):318-26. doi: 10.1016/j.cbi.2008.05.038. Epub 2008 Jun 12.
• [45] Proteomic analysis of liver cancer cells treated with suberonylanilide hydroxamic acid. Cancer Chemother Pharmacol. 2008 Apr;61(5):791-802.
• [46] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [47] Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
• [48] Increased sensitivity for troglitazone-induced cytotoxicity using a human in vitro co-culture model. Toxicol In Vitro. 2009 Oct;23(7):1387-95.
• [49] Survival of retinal pigment epithelium after exposure to prolonged oxidative injury: a detailed gene expression and cellular analysis. Invest Ophthalmol Vis Sci. 2004 Oct;45(10):3767-77.
• [50] Effects of acute ethanol treatment on NCCIT cells and NCCIT cell-derived embryoid bodies (EBs). Toxicol In Vitro. 2010 Sep;24(6):1696-704. doi: 10.1016/j.tiv.2010.05.017. Epub 2010 May 26.
• [51] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [52] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [53] Untargeted Proteomics and Systems-Based Mechanistic Investigation of Artesunate in Human Bronchial Epithelial Cells. Chem Res Toxicol. 2015 Oct 19;28(10):1903-13. doi: 10.1021/acs.chemrestox.5b00105. Epub 2015 Sep 21.
• [54] Consequences of the natural retinoid/retinoid X receptor ligands action in human breast cancer MDA-MB-231 cell line: Focus on functional proteomics. Toxicol Lett. 2017 Nov 5;281:26-34. doi: 10.1016/j.toxlet.2017.09.001. Epub 2017 Sep 5.
• [55] Calorie restriction-induced changes in the secretome of human adipocytes, comparison with resveratrol-induced secretome effects. Biochim Biophys Acta. 2014 Sep;1844(9):1511-22. doi: 10.1016/j.bbapap.2014.04.023. Epub 2014 May 5.
• [56] Anticarcinogenic effect of indole-3-carbinol (I3C) on human hepatocellular carcinoma SNU449 cells. Hum Exp Toxicol. 2019 Jan;38(1):136-147. doi: 10.1177/0960327118785235. Epub 2018 Jul 11.
• [57] Capturing time-dependent activation of genes and stress-response pathways using transcriptomics in iPSC-derived renal proximal tubule cells. Cell Biol Toxicol. 2023 Aug;39(4):1773-1793. doi: 10.1007/s10565-022-09783-5. Epub 2022 Dec 31.
• [58] The thioredoxin reductase inhibitor auranofin triggers apoptosis through a Bax/Bak-dependent process that involves peroxiredoxin 3 oxidation. Biochem Pharmacol. 2008 Oct 30;76(9):1097-109.
• [59] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [60] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [61] Synergistic effect of trichostatin A and 5-aza-2'-deoxycytidine on growth inhibition of pancreatic endocrine tumour cell lines: a proteomic study. Proteomics. 2009 Apr;9(7):1952-66. doi: 10.1002/pmic.200701089.
• [62] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [63] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [64] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [65] Quercetin reduces oxidative damage induced by paraquat via modulating expression of antioxidant genes in A549 cells. J Appl Toxicol. 2013 Dec;33(12):1460-7. doi: 10.1002/jat.2812. Epub 2012 Sep 20.
• [66] Imbalance in the antioxidant defence system and pro-genotoxic status induced by high glucose concentrations: In vitro testing in human liver cells. Toxicol In Vitro. 2020 Dec;69:105001. doi: 10.1016/j.tiv.2020.105001. Epub 2020 Sep 15.
• [67] Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.
• [68] Identification of protein targets of 4-hydroxynonenal using click chemistry for ex vivo biotinylation of azido and alkynyl derivatives. Chem Res Toxicol. 2008 Feb;21(2):432-44. doi: 10.1021/tx700347w. Epub 2008 Jan 31.
• [69] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [70] The effects of acrolein on peroxiredoxins, thioredoxins, and thioredoxin reductase in human bronchial epithelial cells. Toxicology. 2009 Mar 4;257(1-2):95-104.