Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZOUPCA)

• DOT Name: C-X-C motif chemokine 5 (CXCL5)
• Synonyms: ENA-78(1-78); Epithelial-derived neutrophil-activating protein 78; Neutrophil-activating peptide ENA-78; Small-inducible cytokine B5
• Gene Name: CXCL5
• Related Disease:
  Breast cancer
  Melanoma
  Acute myocardial infarction
  Adenocarcinoma
  Adult respiratory distress syndrome
  Allergy
  Autoimmune disease
  Bladder cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma
  Cardiovascular disease
  Cervical cancer
  Chronic obstructive pulmonary disease
  Clear cell renal carcinoma
  Colorectal neoplasm
  Coronary heart disease
  Crohn disease
  Endometriosis
  Hepatocellular carcinoma
  Hypersensitivity pneumonitis
  Metastatic malignant neoplasm
  Non-insulin dependent diabetes
  Obesity
  Pancreatic cancer
  Pneumonia
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Rheumatoid arthritis
  Sarcoidosis
  Squamous cell carcinoma
  Type-1/2 diabetes
  Ulcerative colitis
  Urinary bladder cancer
  Urinary bladder neoplasm
  High blood pressure
  Intrahepatic cholangiocarcinoma
  Lung adenocarcinoma
  Non-small-cell lung cancer
  Prostate neoplasm
  Acute myelogenous leukaemia
  Bone osteosarcoma
  Coronary atherosclerosis
  Gastric cancer
  Inflammatory bowel disease
  Osteosarcoma
  Pneumonitis
  Stomach cancer
• UniProt ID: CXCL5_HUMAN
• PDB ID: 2MGS
• Pfam ID: PF00048
• Sequence:
  MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHP
  KMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
• Function: Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Viral protein interaction with cytokine and cytokine receptor (hsa04061)
  Chemokine sig.ling pathway (hsa04062)
  IL-17 sig.ling pathway (hsa04657)
  TNF sig.ling pathway (hsa04668)
  Pertussis (hsa05133)
  Rheumatoid arthritis (hsa05323)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  Chemokine receptors bind chemokines (R-HSA-380108)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Definitive	Biomarker	[1]
Melanoma	DIS1RRCY	Definitive	Altered Expression	[2]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[3]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[4]
Adult respiratory distress syndrome	DISIJV47	Strong	Biomarker	[5]
Allergy	DIS48ZAP	Strong	Biomarker	[6]
Autoimmune disease	DISORMTM	Strong	Altered Expression	[7]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[8]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[10]
Carcinoma	DISH9F1N	Strong	Altered Expression	[11]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[12]
Cervical cancer	DISFSHPF	Strong	Altered Expression	[13]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Biomarker	[14]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[15]
Colorectal neoplasm	DISR1UCN	Strong	Altered Expression	[16]
Coronary heart disease	DIS5OIP1	Strong	Altered Expression	[17]
Crohn disease	DIS2C5Q8	Strong	Altered Expression	[18]
Endometriosis	DISX1AG8	Strong	Altered Expression	[19]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[20]
Hypersensitivity pneumonitis	DIS5IW5K	Strong	Altered Expression	[21]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[22]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Altered Expression	[23]
Obesity	DIS47Y1K	Strong	Biomarker	[24]
Pancreatic cancer	DISJC981	Strong	Biomarker	[25]
Pneumonia	DIS8EF3M	Strong	Altered Expression	[5]
Prostate cancer	DISF190Y	Strong	Altered Expression	[22]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[22]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[15]
Rheumatoid arthritis	DISTSB4J	Strong	Altered Expression	[24]
Sarcoidosis	DISE5B8Z	Strong	Altered Expression	[26]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[27]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[17]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[28]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[8]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[8]
High blood pressure	DISY2OHH	moderate	Biomarker	[29]
Intrahepatic cholangiocarcinoma	DIS6GOC8	moderate	Altered Expression	[30]
Lung adenocarcinoma	DISD51WR	moderate	Biomarker	[31]
Non-small-cell lung cancer	DIS5Y6R9	moderate	Biomarker	[32]
Prostate neoplasm	DISHDKGQ	moderate	Biomarker	[22]
Acute myelogenous leukaemia	DISCSPTN	Disputed	Biomarker	[33]
Bone osteosarcoma	DIST1004	Limited	Altered Expression	[34]
Coronary atherosclerosis	DISKNDYU	Limited	Biomarker	[17]
Gastric cancer	DISXGOUK	Limited	Biomarker	[35]
Inflammatory bowel disease	DISGN23E	Limited	Biomarker	[36]
Osteosarcoma	DISLQ7E2	Limited	Altered Expression	[34]
Pneumonitis	DIS88E0K	Limited	Altered Expression	[5]
Stomach cancer	DISKIJSX	Limited	Biomarker	[35]

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	C-X-C motif chemokine 5 (CXCL5) affects the response to substance of Paclitaxel.	[62]
Mitomycin	DMH0ZJE	Approved	C-X-C motif chemokine 5 (CXCL5) affects the response to substance of Mitomycin.	[62]
Vinblastine	DM5TVS3	Approved	C-X-C motif chemokine 5 (CXCL5) affects the response to substance of Vinblastine.	[62]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of C-X-C motif chemokine 5 (CXCL5).	[37]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of C-X-C motif chemokine 5 (CXCL5).	[38]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of C-X-C motif chemokine 5 (CXCL5).	[39]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of C-X-C motif chemokine 5 (CXCL5).	[40]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of C-X-C motif chemokine 5 (CXCL5).	[41]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of C-X-C motif chemokine 5 (CXCL5).	[42]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of C-X-C motif chemokine 5 (CXCL5).	[43]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of C-X-C motif chemokine 5 (CXCL5).	[44]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of C-X-C motif chemokine 5 (CXCL5).	[45]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of C-X-C motif chemokine 5 (CXCL5).	[46]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of C-X-C motif chemokine 5 (CXCL5).	[47]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of C-X-C motif chemokine 5 (CXCL5).	[43]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of C-X-C motif chemokine 5 (CXCL5).	[48]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of C-X-C motif chemokine 5 (CXCL5).	[49]
Malathion	DMXZ84M	Approved	Malathion increases the expression of C-X-C motif chemokine 5 (CXCL5).	[50]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of C-X-C motif chemokine 5 (CXCL5).	[51]
Mifepristone	DMGZQEF	Approved	Mifepristone increases the expression of C-X-C motif chemokine 5 (CXCL5).	[52]
Ritonavir	DMU764S	Approved	Ritonavir decreases the expression of C-X-C motif chemokine 5 (CXCL5).	[53]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of C-X-C motif chemokine 5 (CXCL5).	[43]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of C-X-C motif chemokine 5 (CXCL5).	[43]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of C-X-C motif chemokine 5 (CXCL5).	[55]
PIRINIXIC ACID	DM82Y75	Preclinical	PIRINIXIC ACID increases the expression of C-X-C motif chemokine 5 (CXCL5).	[56]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of C-X-C motif chemokine 5 (CXCL5).	[58]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of C-X-C motif chemokine 5 (CXCL5).	[59]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of C-X-C motif chemokine 5 (CXCL5).	[60]
Paraoxon	DMN4ZKC	Investigative	Paraoxon increases the expression of C-X-C motif chemokine 5 (CXCL5).	[61]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of C-X-C motif chemokine 5 (CXCL5).	[54]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of C-X-C motif chemokine 5 (CXCL5).	[57]

References

• [1] Resistance to lysosomotropic drugs used to treat kidney and breast cancers involves autophagy and inflammation and converges in inducing CXCL5.Theranostics. 2019 Jan 30;9(4):1181-1199. doi: 10.7150/thno.29093. eCollection 2019.
• [2] CXCL5 as Regulator of Neutrophil Function inCutaneous Melanoma.J Invest Dermatol. 2019 Jan;139(1):186-194. doi: 10.1016/j.jid.2018.07.006. Epub 2018 Oct 4.
• [3] Intracoronary nitrite suppresses the inflammatory response following primary percutaneous coronary intervention.Heart. 2017 Apr;103(7):508-516. doi: 10.1136/heartjnl-2016-309748. Epub 2016 Sep 28.
• [4] The clinical significance of CXCL5 in non-small cell lung cancer.Onco Targets Ther. 2017 Nov 21;10:5561-5573. doi: 10.2147/OTT.S148772. eCollection 2017.
• [5] Phospholipase C plays a crucial role in neutrophilic inflammation accompanying acute lung injury through augmentation of CXC chemokine production from alveolar epithelial cells.Respir Res. 2019 Jan 11;20(1):9. doi: 10.1186/s12931-019-0975-4.
• [6] Expansion of CD4(+) CD25(+) and CD25(-) T-Bet, GATA-3, Foxp3 and RORt cells in allergic inflammation, local lung distribution and chemokine gene expression.PLoS One. 2011;6(5):e19889. doi: 10.1371/journal.pone.0019889. Epub 2011 May 19.
• [7] Increased serum production of soluble CD163 and CXCL5 in patients with moyamoya disease: Involvement of intrinsic immune reaction in its pathogenesis.Brain Res. 2018 Jan 15;1679:39-44. doi: 10.1016/j.brainres.2017.11.013. Epub 2017 Nov 22.
• [8] CXCL5 promotes mitomycin C resistance in non-muscle invasive bladder cancer by activating EMT and NF-B pathway.Biochem Biophys Res Commun. 2018 Apr 15;498(4):862-868. doi: 10.1016/j.bbrc.2018.03.071. Epub 2018 Mar 17.
• [9] The CXCL5/CXCR2 axis is sufficient to promote breast cancer colonization during bone metastasis.Nat Commun. 2019 Sep 27;10(1):4404. doi: 10.1038/s41467-019-12108-6.
• [10] CXCL5 secreted from adipose tissue-derived stem cells promotes cancer cell proliferation.Oncol Lett. 2018 Feb;15(2):1403-1410. doi: 10.3892/ol.2017.7522. Epub 2017 Dec 5.
• [11] Enhanced ENA-78 and IL-8 expression in patients with malignant pancreatic diseases.Pancreatology. 2008;8(4-5):488-97. doi: 10.1159/000151776. Epub 2008 Sep 3.
• [12] Massive analysis of cDNA Ends (MACE) and miRNA expression profiling identifies proatherogenic pathways in chronic kidney disease.Epigenetics. 2014 Jan;9(1):161-72. doi: 10.4161/epi.26931. Epub 2013 Nov 1.
• [13] CXCL3 overexpression promotes the tumorigenic potential of uterine cervical cancer cells via the MAPK/ERK pathway.J Cell Physiol. 2020 May;235(5):4756-4765. doi: 10.1002/jcp.29353. Epub 2019 Oct 30.
• [14] The elevated CXCL5 levels in circulation are associated with lung function decline in COPD patients and cigarette smoking-induced mouse model of COPD.Ann Med. 2019 Aug-Sep;51(5-6):314-329. doi: 10.1080/07853890.2019.1639809. Epub 2019 Jul 16.
• [15] Androgen receptor (AR) signaling promotes RCC progression via increased endothelial cell proliferation and recruitment by modulating AKTNF-BCXCL5 signaling.Sci Rep. 2016 Nov 16;6:37085. doi: 10.1038/srep37085.
• [16] Disrupted expression of CXCL5 in colorectal cancer is associated with rapid tumor formation in rats and poor prognosis in patients.Clin Cancer Res. 2008 Apr 15;14(8):2276-84. doi: 10.1158/1078-0432.CCR-07-4045.
• [17] Clinical Evidence Supports a Protective Role for CXCL5 in Coronary Artery Disease.Am J Pathol. 2017 Dec;187(12):2895-2911. doi: 10.1016/j.ajpath.2017.08.006. Epub 2017 Nov 16.
• [18] Expression and gene polymorphisms of the chemokine CXCL5 in colorectal cancer patients.Int J Oncol. 2007 Jul;31(1):97-102.
• [19] Peritoneal fluid concentrations of epithelial neutrophil-activating peptide-78 correlate with the severity of endometriosis.Fertil Steril. 2004 Feb;81(2):305-8. doi: 10.1016/j.fertnstert.2003.08.011.
• [20] Longitudinal studies can identify distinct inflammatory cytokines associated with the inhibition or progression of liver cancer.Liver Int. 2020 Feb;40(2):468-472. doi: 10.1111/liv.14323. Epub 2019 Dec 26.
• [21] Interleukin-17A and Neutrophils in a Murine Model of Bird-Related Hypersensitivity Pneumonitis.PLoS One. 2015 Sep 14;10(9):e0137978. doi: 10.1371/journal.pone.0137978. eCollection 2015.
• [22] Apoptosis-induced CXCL5 accelerates inflammation and growth of prostate tumor metastases in bone.J Clin Invest. 2018 Jan 2;128(1):248-266. doi: 10.1172/JCI92466. Epub 2017 Nov 27.
• [23] Sitagliptin, a dipeptidyl peptidase-4 inhibitor, suppresses CXCL5 and SDF-1 and does not accelerate intestinal neoplasia formation in Apc(Min/+) mice fed a high-fat diet.Oncol Lett. 2017 Oct;14(4):4355-4360. doi: 10.3892/ol.2017.6698. Epub 2017 Aug 1.
• [24] Implication of CXCL5 (epithelial neutrophil-activating peptide 78) in the development of insulin resistance in patients with rheumatoid arthritis.Clin Exp Rheumatol. 2019 May-Jun;37(3):373-379. Epub 2018 Sep 17.
• [25] Overexpression of CXCL5 is associated with poor survival in patients with pancreatic cancer.Am J Pathol. 2011 Mar;178(3):1340-9. doi: 10.1016/j.ajpath.2010.11.058.
• [26] Cytokine gene polymorphisms and BALF cytokine levels in interstitial lung diseases.Respir Med. 2009 May;103(5):773-9. doi: 10.1016/j.rmed.2008.11.006. Epub 2008 Dec 30.
• [27] Down-regulation of CXCL5 inhibits squamous carcinogenesis.Cancer Res. 2006 Apr 15;66(8):4279-84. doi: 10.1158/0008-5472.CAN-05-4398.
• [28] MicroRNA-141 Is Involved in Ulcerative Colitis Pathogenesis via Aiming at CXCL5.J Interferon Cytokine Res. 2017 Sep;37(9):415-420. doi: 10.1089/jir.2017.0019.
• [29] CXCL5 polymorphisms are associated with variable blood pressure in cardiovascular disease-free adults.Hum Genomics. 2012 Aug 2;6(1):9. doi: 10.1186/1479-7364-6-9.
• [30] Prognostic significance of CXCL5 expression in cancer patients: a meta-analysis.Cancer Cell Int. 2018 May 2;18:68. doi: 10.1186/s12935-018-0562-7. eCollection 2018.
• [31] CXCR2 expression in tumor cells is a poor prognostic factor and promotes invasion and metastasis in lung adenocarcinoma.Cancer Res. 2013 Jan 15;73(2):571-82. doi: 10.1158/0008-5472.CAN-12-0263. Epub 2012 Nov 30.
• [32] CXCL5 regulation of proliferation and migration in human non-small cell lung cancer cells.J Physiol Biochem. 2018 May;74(2):313-324. doi: 10.1007/s13105-018-0619-z. Epub 2018 Mar 10.
• [33] The protein kinase C agonist PEP005 increases NF-kappaB expression, induces differentiation and increases constitutive chemokine release by primary acute myeloid leukaemia cells.Br J Haematol. 2009 Jun;145(6):761-74. doi: 10.1111/j.1365-2141.2009.07691.x. Epub 2009 Apr 20.
• [34] CXCL5 Plays a Promoting Role in Osteosarcoma Cell Migration and Invasion in Autocrine- and Paracrine-Dependent Manners.Oncol Res. 2017 Jan 26;25(2):177-186. doi: 10.3727/096504016X14732772150343.
• [35] A C-X-C Chemokine Receptor Type 2-Dominated Cross-talk between Tumor Cells and Macrophages Drives Gastric Cancer Metastasis.Clin Cancer Res. 2019 Jun 1;25(11):3317-3328. doi: 10.1158/1078-0432.CCR-18-3567. Epub 2019 Feb 22.
• [36] Fli1 deficiency contributes to the suppression of endothelial CXCL5 expression in systemic sclerosis.Arch Dermatol Res. 2014 May;306(4):331-8. doi: 10.1007/s00403-013-1431-9. Epub 2013 Nov 29.
• [37] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [38] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [39] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [40] Pattern of expression of apoptosis and inflammatory genes in humans exposed to arsenic and/or fluoride. Sci Total Environ. 2010 Jan 15;408(4):760-7. doi: 10.1016/j.scitotenv.2009.11.016. Epub 2009 Dec 4.
• [41] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [42] Unique signatures of stress-induced senescent human astrocytes. Exp Neurol. 2020 Dec;334:113466. doi: 10.1016/j.expneurol.2020.113466. Epub 2020 Sep 17.
• [43] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [44] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [45] Re-expression of CXCL14, a common target for epigenetic silencing in lung cancer, induces tumor necrosis. Oncogene. 2010 Sep 16;29(37):5159-70. doi: 10.1038/onc.2010.255. Epub 2010 Jun 21.
• [46] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [47] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [48] Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
• [49] Histamine H4 receptor agonists have more activities than H4 agonism in antigen-specific human T-cell responses. Immunology. 2007 Jun;121(2):266-75. doi: 10.1111/j.1365-2567.2007.02574.x. Epub 2007 Mar 7.
• [50] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [51] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [52] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [53] Transcriptional profiling suggests that Nevirapine and Ritonavir cause drug induced liver injury through distinct mechanisms in primary human hepatocytes. Chem Biol Interact. 2016 Aug 5;255:31-44.
• [54] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [55] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [56] Activation of peroxisome proliferator-activated receptor alpha in human peripheral blood mononuclear cells reveals an individual gene expression profile response. BMC Genomics. 2008 Jun 2;9:262. doi: 10.1186/1471-2164-9-262.
• [57] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [58] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [59] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [60] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [61] Genomic and phenotypic alterations of the neuronal-like cells derived from human embryonal carcinoma stem cells (NT2) caused by exposure to organophosphorus compounds paraoxon and mipafox. Int J Mol Sci. 2014 Jan 9;15(1):905-26. doi: 10.3390/ijms15010905.
• [62] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.