Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2CF1E6)

• DOT Name: Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1)
• Synonyms: eIF-4-gamma 1; eIF-4G 1; eIF-4G1; p220
• Gene Name: EIF4G1
• Related Disease:
  Non-insulin dependent diabetes
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Castration-resistant prostate carcinoma
  Colorectal carcinoma
  Cytomegalovirus infection
  Dementia
  Endometrial cancer
  Endometrial carcinoma
  Esophageal adenocarcinoma
  Head and neck cancer
  Head and neck carcinoma
  Hepatocellular carcinoma
  Herpes simplex infection
  Influenza
  Lung cancer
  Lung squamous cell carcinoma
  Malignant glioma
  Malignant peripheral nerve sheath tumor
  Medulloblastoma
  Mesothelioma
  Metastatic malignant neoplasm
  Myocardial ischemia
  Neurodevelopmental disorder
  Non-hodgkin lymphoma
  Parkinsonian disorder
  Plasma cell myeloma
  Squamous cell carcinoma
  Systemic lupus erythematosus
  T-cell leukaemia
  Triple negative breast cancer
  Inflammatory breast cancer
  Lung carcinoma
  Meningioma
  Nasopharyngeal carcinoma
  Parkinson disease 18, autosomal dominant, susceptibility to
  Small lymphocytic lymphoma
  Enterovirus infection
  Hepatitis C virus infection
  IgA nephropathy
  Lewy body dementia
  Matthew-Wood syndrome
  Melanoma
  Non-small-cell lung cancer
  Pancreatic ductal carcinoma
  Rheumatoid arthritis
• UniProt ID: IF4G1_HUMAN
• PDB ID: 1LJ2; 1UG3; 2W97; 4AZA; 4F02; 5EHC; 5EI3; 5EIR; 5T46; 5ZK5; 6ZMW; 8HUJ; 8J7R
• Pfam ID: PF02847 ; PF02854 ; PF02020
• Sequence:
  MNKAPQSTGPPPAPSPGLPQPAFPPGQTAPVVFSTPQATQMNTPSQPRQHFYPSRAQPPS
  SAASRVQSAAPARPGPAAHVYPAGSQVMMIPSQISYPASQGAYYIPGQGRSTYVVPTQQY
  PVQPGAPGFYPGASPTEFGTYAGAYYPAQGVQQFPTGVAPTPVLMNQPPQIAPKRERKTI
  RIRDPNQGGKDITEEIMSGARTASTPTPPQTGGGLEPQANGETPQVAVIVRPDDRSQGAI
  IADRPGLPGPEHSPSESQPSSPSPTPSPSPVLEPGSEPNLAVLSIPGDTMTTIQMSVEES
  TPISRETGEPYRLSPEPTPLAEPILEVEVTLSKPVPESEFSSSPLQAPTPLASHTVEIHE
  PNGMVPSEDLEPEVESSPELAPPPACPSESPVPIAPTAQPEELLNGAPSPPAVDLSPVSE
  PEEQAKEVTASMAPPTIPSATPATAPSATSPAQEEEMEEEEEEEEGEAGEAGEAESEKGG
  EELLPPESTPIPANLSQNLEAAAATQVAVSVPKRRRKIKELNKKEAVGDLLDAFKEANPA
  VPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQ
  WKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANKTPLRPLDPTRLQGI
  NCGPDFTPSFANLGRTTLSTRGPPRGGPGGELPRGPAGLGPRRSQQGPRKEPRKIIATVL
  MTEDIKLNKAEKAWKPSSKRTAADKDRGEEDADGSKTQDLFRRVRSILNKLTPQMFQQLM
  KQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVTVNFR
  KLLLNRCQKEFEKDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIK
  FIGELFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFN
  QMEKIIKEKKTSSRIRFMLQDVLDLRGSNWVPRRGDQGPKTIDQIHKEAEMEEHREHIKV
  QQLMAKGSDKRRGGPPGPPISRGLPLVDDGGWNTVPISKGSRPIDTSRLTKITKPGSIDS
  NNQLFAPGGRLSWGKGSSGGSGAKPSDAASEAARPATSTLNRFSALQQAVPTESTDNRRV
  VQRSSLSRERGEKAGDRGDRLERSERGGDRGDRLDRARTPATKRSFSKEVEERSRERPSQ
  PEGLRKAASLTEDRDRGRDAVKREAALPPVSPLKAALSEEELEKKSKAIIEEYLHLNDMK
  EAVQCVQELASPSLLFIFVRHGVESTLERSAIAREHMGQLLHQLLCAGHLSTAQYYQGLY
  EILELAEDMEIDIPHVWLYLAELVTPILQEGGVPMGELFREITKPLRPLGKAASLLLEIL
  GLLCKSMGPKKVGTLWREAGLSWKEFLPEGQDIGAFVAEQKVEYTLGEESEAPGQRALPS
  EELNRQLEKLLKEGSSNQRVFDWIEANLSEQQIVSNTLVRALMTAVCYSAIIFETPLRVD
  VAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAF
  YSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN
• Function: Component of the protein complex eIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure and recruitment of mRNA to the ribosome. Exists in two complexes, either with EIF1 or with EIF4E (mutually exclusive). Together with EIF1, is required for leaky scanning, in particular for avoiding cap-proximal start codon. Together with EIF4E, antagonizes the scanning promoted by EIF1-EIF4G1 and locates the start codon (through a TISU element) without scanning. As a member of the eIF4F complex, required for endoplasmic reticulum stress-induced ATF4 mRNA translation.
• KEGG Pathway: Viral myocarditis (hsa05416)
• Reactome Pathway:
  L13a-mediated translational silencing of Ceruloplasmin expression (R-HSA-156827)
  mTORC1-mediated signalling (R-HSA-166208)
  Deadenylation of mRNA (R-HSA-429947)
  AUF1 (hnRNP D0) binds and destabilizes mRNA (R-HSA-450408)
  Translation initiation complex formation (R-HSA-72649)
  Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S (R-HSA-72662)
  Ribosomal scanning and start codon recognition (R-HSA-72702)
  GTP hydrolysis and joining of the 60S ribosomal subunit (R-HSA-72706)
  Regulation of expression of SLITs and ROBOs (R-HSA-9010553)
  Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC) (R-HSA-975956)
  Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC) (R-HSA-975957)
  M-decay (R-HSA-9820841)
  Z-decay (R-HSA-9820865)
  ISG15 antiviral mechanism (R-HSA-1169408)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Genetic Variation	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[3]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[3]
Castration-resistant prostate carcinoma	DISVGAE6	Strong	Biomarker	[4]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[5]
Cytomegalovirus infection	DISCEMGC	Strong	Altered Expression	[6]
Dementia	DISXL1WY	Strong	Biomarker	[7]
Endometrial cancer	DISW0LMR	Strong	Altered Expression	[8]
Endometrial carcinoma	DISXR5CY	Strong	Altered Expression	[8]
Esophageal adenocarcinoma	DISODWFP	Strong	Altered Expression	[9]
Head and neck cancer	DISBPSQZ	Strong	Genetic Variation	[2]
Head and neck carcinoma	DISOU1DS	Strong	Genetic Variation	[2]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[10]
Herpes simplex infection	DISL1SAV	Strong	Altered Expression	[11]
Influenza	DIS3PNU3	Strong	Biomarker	[12]
Lung cancer	DISCM4YA	Strong	Biomarker	[13]
Lung squamous cell carcinoma	DISXPIBD	Strong	Biomarker	[14]
Malignant glioma	DISFXKOV	Strong	Biomarker	[15]
Malignant peripheral nerve sheath tumor	DIS0JTN6	Strong	Altered Expression	[16]
Medulloblastoma	DISZD2ZL	Strong	Biomarker	[17]
Mesothelioma	DISKWK9M	Strong	Biomarker	[18]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[19]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[20]
Neurodevelopmental disorder	DIS372XH	Strong	Genetic Variation	[21]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Biomarker	[22]
Parkinsonian disorder	DISHGY45	Strong	Biomarker	[7]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[23]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[14]
Systemic lupus erythematosus	DISI1SZ7	Strong	Altered Expression	[24]
T-cell leukaemia	DISJ6YIF	Strong	Biomarker	[25]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[3]
Inflammatory breast cancer	DIS3QRWA	moderate	Altered Expression	[26]
Lung carcinoma	DISTR26C	moderate	Biomarker	[27]
Meningioma	DISPT4TG	moderate	Altered Expression	[28]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Altered Expression	[29]
Parkinson disease 18, autosomal dominant, susceptibility to	DISXTIUR	Moderate	Autosomal dominant	[30]
Small lymphocytic lymphoma	DIS30POX	moderate	Posttranslational Modification	[31]
Enterovirus infection	DISH2UDP	Limited	Biomarker	[32]
Hepatitis C virus infection	DISQ0M8R	Limited	Biomarker	[33]
IgA nephropathy	DISZ8MTK	Limited	Biomarker	[34]
Lewy body dementia	DISAE66J	Limited	Genetic Variation	[7]
Matthew-Wood syndrome	DISA7HR7	Limited	Altered Expression	[35]
Melanoma	DIS1RRCY	Limited	Altered Expression	[36]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Biomarker	[37]
Pancreatic ductal carcinoma	DIS26F9Q	Limited	Biomarker	[35]
Rheumatoid arthritis	DISTSB4J	Limited	Biomarker	[38]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Josamycin	DMKJ8LB	Approved	Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1) affects the response to substance of Josamycin.	[59]

7 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[39]
Estradiol	DMUNTE3	Approved	Estradiol increases the phosphorylation of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[44]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the phosphorylation of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[52]
G1	DMTV42K	Phase 1/2	G1 decreases the phosphorylation of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[54]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[55]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[56]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[56]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[41]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[42]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[43]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[45]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[46]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[47]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[48]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[49]
Selenium	DM25CGV	Approved	Selenium increases the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[50]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[51]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[48]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[53]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[50]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[57]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1).	[58]

References

• [1] A novel TCF7L2 type 2 diabetes SNP identified from fine mapping in African American women.PLoS One. 2017 Mar 2;12(3):e0172577. doi: 10.1371/journal.pone.0172577. eCollection 2017.
• [2] Eukaryotic Translation Initiation Factor 4 Gamma 1 (EIF4G1): a target for cancer therapeutic intervention?.Cancer Cell Int. 2019 Aug 31;19:224. doi: 10.1186/s12935-019-0947-2. eCollection 2019.
• [3] The CXCR4-LASP1-eIF4F Axis Promotes Translation of Oncogenic Proteins in Triple-Negative Breast Cancer Cells.Front Oncol. 2019 Apr 24;9:284. doi: 10.3389/fonc.2019.00284. eCollection 2019.
• [4] Eukaryotic Translation Initiation Factor 4 Gamma 1 (eIF4G1) is upregulated during Prostate cancer progression and modulates cell growth and metastasis.Sci Rep. 2018 May 10;8(1):7459. doi: 10.1038/s41598-018-25798-7.
• [5] Metformin blocks MYC protein synthesis in colorectal cancer via mTOR-4EBP-eIF4E and MNK1-eIF4G-eIF4E signaling.Mol Oncol. 2018 Nov;12(11):1856-1870. doi: 10.1002/1878-0261.12384. Epub 2018 Oct 15.
• [6] Differential role for host translation factors in host and viral protein synthesis during human cytomegalovirus infection.J Virol. 2014 Feb;88(3):1473-83. doi: 10.1128/JVI.02321-13. Epub 2013 Nov 6.
• [7] Sequence variants in eukaryotic translation initiation factor 4-gamma (eIF4G1) are associated with Lewy body dementia.Acta Neuropathol. 2013 Mar;125(3):425-38. doi: 10.1007/s00401-012-1059-4. Epub 2012 Nov 4.
• [8] The Prognostic Significance of Eukaryotic Translation Initiation Factors (eIFs) in Endometrial Cancer.Int J Mol Sci. 2019 Dec 6;20(24):6169. doi: 10.3390/ijms20246169.
• [9] Cap-dependent mRNA translation and the ubiquitin-proteasome system cooperate to promote ERBB2-dependent esophageal cancer phenotype.Cancer Gene Ther. 2012 Sep;19(9):609-18. doi: 10.1038/cgt.2012.39. Epub 2012 Jul 6.
• [10] New liver cancer biomarkers: PI3K/AKT/mTOR pathway members and eukaryotic translation initiation factors.Eur J Cancer. 2017 Sep;83:56-70. doi: 10.1016/j.ejca.2017.06.003. Epub 2017 Jul 14.
• [11] Phosphorylation of eIF4E by Mnk-1 enhances HSV-1 translation and replication in quiescent cells.Genes Dev. 2004 Mar 15;18(6):660-72. doi: 10.1101/gad.1185304.
• [12] Proteomic analysis of chicken embryo fibroblast cells infected with recombinant H5N1 avian influenza viruses with and without NS1 eIF4GI binding domain.Oncotarget. 2017 Dec 22;9(9):8350-8367. doi: 10.18632/oncotarget.23615. eCollection 2018 Feb 2.
• [13] Targeting EIF4F complex in non-small cell lung cancer cells.Oncotarget. 2017 Jun 8;8(33):55731-55735. doi: 10.18632/oncotarget.18413. eCollection 2017 Aug 15.
• [14] Frequent overexpression of the genes FXR1, CLAPM1 and EIF4G located on amplicon 3q26-27 in squamous cell carcinoma of the lung.Int J Cancer. 2007 Jun 15;120(12):2538-44. doi: 10.1002/ijc.22585.
• [15] Inhibition of eIF4F complex loading inhibits the survival of malignant glioma.Oncol Rep. 2018 Oct;40(4):2399-2407. doi: 10.3892/or.2018.6587. Epub 2018 Jul 20.
• [16] Targeting Protein Translation by Rocaglamide and Didesmethylrocaglamide to Treat MPNST and Other Sarcomas.Mol Cancer Ther. 2020 Mar;19(3):731-741. doi: 10.1158/1535-7163.MCT-19-0809. Epub 2019 Dec 17.
• [17] Proteomic analysis of Medulloblastoma reveals functional biology with translational potential.Acta Neuropathol Commun. 2018 Jun 7;6(1):48. doi: 10.1186/s40478-018-0548-7.
• [18] 4EGI-1 represses cap-dependent translation and regulates genome-wide translation in malignant pleural mesothelioma.Invest New Drugs. 2018 Apr;36(2):217-229. doi: 10.1007/s10637-017-0535-z. Epub 2017 Nov 8.
• [19] eIF4F is a nexus of resistance to anti-BRAF and anti-MEK cancer therapies.Nature. 2014 Sep 4;513(7516):105-9. doi: 10.1038/nature13572. Epub 2014 Jul 27.
• [20] Inhibition of Cap-initiation complexes linked to a novel mechanism of eIF4G depletion in acute myocardial ischemia.Cell Death Differ. 2006 Sep;13(9):1586-94. doi: 10.1038/sj.cdd.4401854. Epub 2006 Jan 27.
• [21] Identification of novel genetic causes of Rett syndrome-like phenotypes. J Med Genet. 2016 Mar;53(3):190-9. doi: 10.1136/jmedgenet-2015-103568. Epub 2016 Jan 6.
• [22] Translation initiation complex eIF4F is a therapeutic target for dual mTOR kinase inhibitors in non-Hodgkin lymphoma.Oncotarget. 2015 Apr 20;6(11):9488-501. doi: 10.18632/oncotarget.3378.
• [23] Mesenchymal stem cells secretomes' affect multiple myeloma translation initiation.Cell Signal. 2016 Jun;28(6):620-30. doi: 10.1016/j.cellsig.2016.03.003. Epub 2016 Mar 11.
• [24] Impaired translational response and increased protein kinase PKR expression in T cells from lupus patients.J Clin Invest. 2000 Dec;106(12):1561-8. doi: 10.1172/JCI9352.
• [25] Hyperactivation of mTORC1 and mTORC2 by multiple oncogenic events causes addiction to eIF4E-dependent mRNA translation in T-cell leukemia.Oncogene. 2015 Jul;34(27):3593-604. doi: 10.1038/onc.2014.290. Epub 2014 Sep 22.
• [26] Inflammatory breast cancer cells are constitutively adapted to hypoxia.Cell Cycle. 2009 Oct 1;8(19):3091-6. doi: 10.4161/cc.8.19.9637. Epub 2009 Oct 23.
• [27] Functional role of eukaryotic translation initiation factor 4 gamma 1 (EIF4G1) in NSCLC.Oncotarget. 2016 Apr 26;7(17):24242-51. doi: 10.18632/oncotarget.8168.
• [28] Overexpression of eIF4F components in meningiomas and suppression of meningioma cell growth by inhibiting translation initiation.Exp Neurol. 2018 Jan;299(Pt B):299-307. doi: 10.1016/j.expneurol.2017.06.015. Epub 2017 Jun 10.
• [29] Over-expression of eukaryotic translation initiation factor 4 gamma 1 correlates with tumor progression and poor prognosis in nasopharyngeal carcinoma.Mol Cancer. 2010 Apr 16;9:78. doi: 10.1186/1476-4598-9-78.
• [30] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [31] RPPA-based protein profiling reveals eIF4G overexpression and 4E-BP1 serine 65 phosphorylation as molecular events that correspond with a pro-survival phenotype in chronic lymphocytic leukemia.Oncotarget. 2015 Jun 10;6(16):14632-45. doi: 10.18632/oncotarget.4104.
• [32] The mammalian host protein DAP5 facilitates the initial round of translation of Coxsackievirus B3 RNA.J Biol Chem. 2019 Oct 18;294(42):15386-15394. doi: 10.1074/jbc.RA119.009000. Epub 2019 Aug 27.
• [33] The Initiation Factors eIF2, eIF2A, eIF2D, eIF4A, and eIF4G Are Not Involved in Translation Driven by Hepatitis C Virus IRES in Human Cells.Front Microbiol. 2018 Feb 13;9:207. doi: 10.3389/fmicb.2018.00207. eCollection 2018.
• [34] Biomarker prediction for membranous nephropathy prognosis by microarray analysis.Nephrology (Carlton). 2019 May;24(5):526-533. doi: 10.1111/nep.13446.
• [35] Prognostic significance of EIF4G1 in patients with pancreatic ductal adenocarcinoma.Onco Targets Ther. 2019 Apr 15;12:2853-2859. doi: 10.2147/OTT.S202101. eCollection 2019.
• [36] Translational control of tumor immune escape via the eIF4F-STAT1-PD-L1 axis in melanoma.Nat Med. 2018 Dec;24(12):1877-1886. doi: 10.1038/s41591-018-0217-1. Epub 2018 Oct 29.
• [37] Inhibition of oncogenic cap-dependent translation by 4EGI-1 reduces growth, enhances chemosensitivity and alters genome-wide translation in non-small cell lung cancer.Cancer Gene Ther. 2019 May;26(5-6):157-165. doi: 10.1038/s41417-018-0058-6. Epub 2018 Nov 12.
• [38] Identification of citrullinated eukaryotic translation initiation factor 4G1 as novel autoantigen in rheumatoid arthritis.Biochem Biophys Res Commun. 2006 Mar 3;341(1):94-100. doi: 10.1016/j.bbrc.2005.12.160. Epub 2006 Jan 6.
• [39] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [40] Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
• [41] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [42] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [43] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [44] Dual inhibition of mTOR and estrogen receptor signaling in vitro induces cell death in models of breast cancer. Clin Cancer Res. 2005 Jul 15;11(14):5319-28. doi: 10.1158/1078-0432.CCR-04-2402.
• [45] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [46] Characterization of arsenic trioxide resistant clones derived from Jurkat leukemia T cell line: focus on PI3K/Akt signaling pathway. Chem Biol Interact. 2013 Oct 5;205(3):198-211. doi: 10.1016/j.cbi.2013.07.011. Epub 2013 Aug 2.
• [47] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [48] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [49] Gene induction and apoptosis in human hepatocellular carci-noma cells SMMC-7721 exposed to 5-aza-2'-deoxycytidine. Chin Med J (Engl). 2007 Sep 20;120(18):1626-31.
• [50] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [51] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [52] Curcumin inhibits Akt/mammalian target of rapamycin signaling through protein phosphatase-dependent mechanism. Mol Cancer Ther. 2008 Sep;7(9):2609-20. doi: 10.1158/1535-7163.MCT-07-2400.
• [53] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [54] The G Protein-Coupled Estrogen Receptor Agonist G-1 Inhibits Nuclear Estrogen Receptor Activity and Stimulates Novel Phosphoproteomic Signatures. Toxicol Sci. 2016 Jun;151(2):434-46. doi: 10.1093/toxsci/kfw057. Epub 2016 Mar 29.
• [55] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [56] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [57] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [58] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [59] A genome-wide analysis of targets of macrolide antibiotics in mammalian cells. J Biol Chem. 2020 Feb 14;295(7):2057-2067. doi: 10.1074/jbc.RA119.010770. Epub 2020 Jan 8.