Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2HZRBD)

• DOT Name: Insulin-like growth factor-binding protein 4 (IGFBP4)
• Synonyms: IBP-4; IGF-binding protein 4; IGFBP-4
• Gene Name: IGFBP4
• Related Disease:
  Adenocarcinoma
  Acute coronary syndrome
  Adult glioblastoma
  Advanced cancer
  Asthma
  Astrocytoma
  Carcinoma
  Cardiovascular disease
  Clear cell renal carcinoma
  Colon cancer
  Colorectal carcinoma
  Coronary atherosclerosis
  Coronary heart disease
  Diabetic kidney disease
  Estrogen-receptor positive breast cancer
  Fatty liver disease
  Glioblastoma multiforme
  Hepatitis C virus infection
  Inflammatory bowel disease
  leukaemia
  Leukemia
  Lung carcinoma
  Metabolic disorder
  Myocardial infarction
  Neoplasm
  Non-alcoholic fatty liver disease
  Non-insulin dependent diabetes
  Plasma cell myeloma
  Polycystic ovarian syndrome
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Pulmonary disease
  Renal cell carcinoma
  Schizophrenia
  Thyroid cancer
  Thyroid gland carcinoma
  Lung cancer
  Neuroblastoma
  Melanoma
  Breast cancer
  Breast carcinoma
  Cardiac failure
  Colon carcinoma
  Congestive heart failure
  Lung adenocarcinoma
  Non-small-cell lung cancer
  Rheumatoid arthritis
• UniProt ID: IBP4_HUMAN
• PDB ID: 1WQJ; 2DSP; 2DSQ; 2DSR
• Pfam ID: PF00219 ; PF00086
• Sequence:
  MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCA
  LGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDE
  GDHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHR
  ALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGG
  LEPKGELDCHQLADSFRE
• Function: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
• Reactome Pathway:
  Post-translational protein phosphorylation (R-HSA-8957275)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)
• BioCyc Pathway: MetaCyc:ENSG00000141753-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Definitive	Altered Expression	[1]
Acute coronary syndrome	DIS7DYEW	Strong	Biomarker	[2]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[3]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[4]
Asthma	DISW9QNS	Strong	Altered Expression	[5]
Astrocytoma	DISL3V18	Strong	Altered Expression	[6]
Carcinoma	DISH9F1N	Strong	Altered Expression	[7]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[8]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[6]
Colon cancer	DISVC52G	Strong	Biomarker	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[9]
Coronary atherosclerosis	DISKNDYU	Strong	Biomarker	[10]
Coronary heart disease	DIS5OIP1	Strong	Biomarker	[10]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[11]
Estrogen-receptor positive breast cancer	DIS1H502	Strong	Altered Expression	[12]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[13]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[6]
Hepatitis C virus infection	DISQ0M8R	Strong	Genetic Variation	[14]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[15]
leukaemia	DISS7D1V	Strong	Biomarker	[16]
Leukemia	DISNAKFL	Strong	Biomarker	[16]
Lung carcinoma	DISTR26C	Strong	Biomarker	[17]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[18]
Myocardial infarction	DIS655KI	Strong	Biomarker	[10]
Neoplasm	DISZKGEW	Strong	Biomarker	[19]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[13]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[20]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[21]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Altered Expression	[22]
Prostate cancer	DISF190Y	Strong	Altered Expression	[23]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[23]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[24]
Pulmonary disease	DIS6060I	Strong	Biomarker	[25]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[6]
Schizophrenia	DISSRV2N	Strong	Biomarker	[26]
Thyroid cancer	DIS3VLDH	Strong	Biomarker	[27]
Thyroid gland carcinoma	DISMNGZ0	Strong	Biomarker	[27]
Lung cancer	DISCM4YA	moderate	Biomarker	[17]
Neuroblastoma	DISVZBI4	moderate	Biomarker	[28]
Melanoma	DIS1RRCY	Disputed	Altered Expression	[29]
Breast cancer	DIS7DPX1	Limited	Biomarker	[4]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[4]
Cardiac failure	DISDC067	Limited	Biomarker	[30]
Colon carcinoma	DISJYKUO	Limited	Biomarker	[9]
Congestive heart failure	DIS32MEA	Limited	Biomarker	[30]
Lung adenocarcinoma	DISD51WR	Limited	Posttranslational Modification	[1]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Biomarker	[31]
Rheumatoid arthritis	DISTSB4J	Limited	Altered Expression	[32]

34 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[33]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[34]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[35]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[36]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[37]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[38]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[39]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[34]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[40]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[41]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[42]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[43]
Selenium	DM25CGV	Approved	Selenium increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[44]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[45]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[46]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[47]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[48]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[49]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[50]
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[51]
Imatinib	DM7RJXL	Approved	Imatinib increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[52]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[53]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[54]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[44]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[45]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[55]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[56]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[57]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[58]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[59]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[60]
Cycloheximide	DMGDA3C	Investigative	Cycloheximide increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[45]
ELLAGIC ACID	DMX8BS5	Investigative	ELLAGIC ACID decreases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[61]
Daidzein	DMRFTJX	Investigative	Daidzein increases the expression of Insulin-like growth factor-binding protein 4 (IGFBP4).	[54]

References

• [1] Insulin-like growth factor binding protein-4 gene silencing in lung adenocarcinomas.Pathol Int. 2011 Jan;61(1):19-27. doi: 10.1111/j.1440-1827.2010.02612.x. Epub 2010 Nov 3.
• [2] Glycosylated and non-glycosylated NT-IGFBP-4 in circulation of acute coronary syndrome patients.Clin Biochem. 2018 May;55:56-62. doi: 10.1016/j.clinbiochem.2018.03.004. Epub 2018 Mar 8.
• [3] Insulin-like growth factor binding protein-4 (IGFBP-4) is a novel anti-angiogenic and anti-tumorigenic mediator secreted by dibutyryl cyclic AMP (dB-cAMP)-differentiated glioblastoma cells.Glia. 2006 Jun;53(8):845-57. doi: 10.1002/glia.20345.
• [4] Serum Levels of Activins, Follistatins, and Growth Factors in Neoplasms of the Breast: A Case-Control Study.J Clin Endocrinol Metab. 2019 Feb 1;104(2):349-358. doi: 10.1210/jc.2018-01581.
• [5] Pregnancy-associated plasma protein-A (PAPP-A) levels in patients with severe allergic asthma are reduced by omalizumab.J Asthma. 2018 Oct;55(10):1116-1121. doi: 10.1080/02770903.2017.1396471. Epub 2017 Dec 6.
• [6] Insulin like growth factor binding protein 4 promotes GBM progression and regulates key factors involved in EMT and invasion.J Neurooncol. 2014 Feb;116(3):455-64. doi: 10.1007/s11060-013-1324-y. Epub 2014 Jan 7.
• [7] Differential gene and protein expression in primary gastric carcinomas and their lymph node metastases as revealed by combined cDNA microarray and tissue microarray analysis.J Dig Dis. 2010 Jun;11(3):167-75. doi: 10.1111/j.1751-2980.2010.00432.x.
• [8] The IGF system in patients with type 2 diabetes: associations with markers of cardiovascular target organ damage.Eur J Endocrinol. 2017 May;176(5):521-531. doi: 10.1530/EJE-16-0940. Epub 2017 Feb 8.
• [9] Insulin-like growth factor binding protein-4 gene therapy increases apoptosis by altering Bcl-2 and Bax proteins and decreases angiogenesis in colorectal cancer.Int J Oncol. 2007 Apr;30(4):883-8.
• [10] Free IGF-1, Intact IGFBP-4, and PicoPAPP-A are Altered in Acute Myocardial Infarction Compared to Stable Coronary Artery Disease and Healthy Controls.Horm Metab Res. 2019 Feb;51(2):112-119. doi: 10.1055/a-0794-6163. Epub 2018 Nov 29.
• [11] ANGPTL4: A Predictive Marker for Diabetic Nephropathy.J Diabetes Res. 2019 Oct 27;2019:4943191. doi: 10.1155/2019/4943191. eCollection 2019.
• [12] Prognostic significance of insulin-like growth factor binding protein (IGFBP)-4 and IGFBP-5 expression in breast cancer.Jpn J Clin Oncol. 2007 Aug;37(8):575-82. doi: 10.1093/jjco/hym066. Epub 2007 Aug 3.
• [13] Targeted Analysis of Three Hormonal Systems Identifies Molecules Associated with the Presence and Severity of NAFLD.J Clin Endocrinol Metab. 2020 Mar 1;105(3):e390-400. doi: 10.1210/clinem/dgz172.
• [14] Genome-Wide Association Study Identifies Risk Variants for Lichen Planus in Patients With Hepatitis C Virus Infection.Clin Gastroenterol Hepatol. 2017 Jun;15(6):937-944.e5. doi: 10.1016/j.cgh.2016.12.029. Epub 2017 Jan 5.
• [15] The IGF system in patients with inflammatory bowel disease treated with prednisolone or infliximab: potential role of the stanniocalcin-2 / PAPP-A / IGFBP-4 axis.BMC Gastroenterol. 2019 Jun 3;19(1):83. doi: 10.1186/s12876-019-1000-6.
• [16] Insulin-like growth factor-binding protein 4 in children with acute lymphoblastic leukemia.Int J Hematol. 2005 Aug;82(2):137-42. doi: 10.1532/IJH97.E0429.
• [17] Insulin-like growth factor binding protein-4 inhibits cell growth, migration and invasion, and downregulates COX-2 expression in A549 lung cancer cells.Cell Biol Int. 2017 Apr;41(4):384-391. doi: 10.1002/cbin.10732. Epub 2017 Feb 21.
• [18] IGFBP-4 and PAPP-A in normal physiology and disease.Growth Horm IGF Res. 2018 Aug;41:7-22. doi: 10.1016/j.ghir.2018.05.002. Epub 2018 May 30.
• [19] Loss of tumor suppressor IGFBP4 drives epigenetic reprogramming in hepatic carcinogenesis.Nucleic Acids Res. 2018 Sep 28;46(17):8832-8847. doi: 10.1093/nar/gky589.
• [20] PAPP-A activity is increased in cerebrospinal fluid from patients with diabetic polyneuropathy and correlates with peripheral nerve impairment.Growth Horm IGF Res. 2019 Oct-Dec;48-49:53-59. doi: 10.1016/j.ghir.2019.10.001. Epub 2019 Oct 17.
• [21] Potential role of insulin-like growth factor binding protein-4 in the uncoupling of bone turnover in multiple myeloma.Br J Haematol. 1999 Mar;104(4):715-22. doi: 10.1046/j.1365-2141.1999.01243.x.
• [22] mRNA expression pattern of insulin-like growth factor components of granulosa cells and cumulus cells in women with and without polycystic ovary syndrome according to oocyte maturity.Fertil Steril. 2010 Nov;94(6):2417-20. doi: 10.1016/j.fertnstert.2010.03.053. Epub 2010 May 8.
• [23] Biology of insulin-like growth factor binding protein-4 and its role in cancer (review).Int J Oncol. 2006 Jun;28(6):1317-25.
• [24] Endoglin regulates cancer-stromal cell interactions in prostate tumors.Cancer Res. 2011 May 15;71(10):3482-93. doi: 10.1158/0008-5472.CAN-10-2665. Epub 2011 Mar 28.
• [25] Insulin-Like Growth Factor Bioactivity, Stanniocalcin-2, Pregnancy-Associated Plasma Protein-A, and IGF-Binding Protein-4 in Pleural Fluid and Serum From Patients With Pulmonary Disease.J Clin Endocrinol Metab. 2017 Sep 1;102(9):3526-3534. doi: 10.1210/jc.2017-00033.
• [26] Gene expression profiling by mRNA sequencing reveals increased expression of immune/inflammation-related genes in the hippocampus of individuals with schizophrenia.Transl Psychiatry. 2013 Oct 29;3(10):e321. doi: 10.1038/tp.2013.94.
• [27] Expression of insulin-like growth factor I (IGF-I) gene and of genes for IGF-binding proteins 1, 2, 3, 4 (IGFBP-1-IGFBP-4) in non-neoplastic human thyroid cells and in certain human thyroid cancers. Effect of exogenous IGF-I on this expression.Endocr Res. 2004 Feb;30(1):47-59. doi: 10.1081/erc-120028484.
• [28] Retinoic acid stimulates IGF binding protein (IGFBP)-6 and depresses IGFBP-2 and IGFBP-4 in SK-N-SH human neuroblastoma cells.J Endocrinol. 1998 Nov;159(2):227-32. doi: 10.1677/joe.0.1590227.
• [29] Inhibition of tumor-associated v3 integrin regulates the angiogenic switch by enhancing expression of IGFBP-4 leading to reduced melanoma growth and angiogenesis in vivo.Angiogenesis. 2015 Jan;18(1):31-46. doi: 10.1007/s10456-014-9445-2. Epub 2014 Sep 24.
• [30] Prognostic value of the Stanniocalcin-2/PAPP-A/IGFBP-4 axis in ST-segment elevation myocardial infarction. Cardiovasc Diabetol. 2018 Apr 30;17(1):63.
• [31] Insulin-like growth factors stimulate the release of insulin-like growth factor-binding protein-3 (IGFBP-3) and degradation of IGFBP-4 in nonsmall cell lung cancer cell lines.J Clin Endocrinol Metab. 1996 Jul;81(7):2653-62. doi: 10.1210/jcem.81.7.8675593.
• [32] MMP-3 expression and release by rheumatoid arthritis fibroblast-like synoviocytes induced with a bacterial ligand of integrin alpha5beta1.Arthritis Res Ther. 2005;7(1):R118-26. doi: 10.1186/ar1462. Epub 2004 Nov 24.
• [33] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [34] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [35] Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
• [36] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [37] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [38] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [39] Identification of estrogen-responsive genes by complementary deoxyribonucleic acid microarray and characterization of a novel early estrogen-induced gene: EEIG1. Mol Endocrinol. 2004 Feb;18(2):402-11. doi: 10.1210/me.2003-0202. Epub 2003 Nov 6.
• [40] Curcumin reduces the expression of survivin, leading to enhancement of arsenic trioxide-induced apoptosis in myelodysplastic syndrome and leukemia stem-like cells. Oncol Rep. 2016 Sep;36(3):1233-42. doi: 10.3892/or.2016.4944. Epub 2016 Jul 15.
• [41] Unique signatures of stress-induced senescent human astrocytes. Exp Neurol. 2020 Dec;334:113466. doi: 10.1016/j.expneurol.2020.113466. Epub 2020 Sep 17.
• [42] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [43] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [44] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [45] Estrogen regulation in human breast cancer cells of new downstream gene targets involved in estrogen metabolism, cell proliferation and cell transformation. J Mol Endocrinol. 2004 Apr;32(2):397-414.
• [46] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [47] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [48] Identification of selective inhibitors of cancer stem cells by high-throughput screening. Cell. 2009 Aug 21;138(4):645-659. doi: 10.1016/j.cell.2009.06.034. Epub 2009 Aug 13.
• [49] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [50] Ethinylestradiol and testosterone have divergent effects on circulating IGF system components in adolescents with constitutional tall stature. Eur J Endocrinol. 2005 Apr;152(4):597-604. doi: 10.1530/eje.1.01880.
• [51] The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
• [52] Effects of Imatinib Mesylate (Gleevec) on human islet NF-kappaB activation and chemokine production in vitro. PLoS One. 2011;6(9):e24831. doi: 10.1371/journal.pone.0024831. Epub 2011 Sep 14.
• [53] Grape resveratrol increases serum adiponectin and downregulates inflammatory genes in peripheral blood mononuclear cells: a triple-blind, placebo-controlled, one-year clinical trial in patients with stable coronary artery disease. Cardiovasc Drugs Ther. 2013 Feb;27(1):37-48. doi: 10.1007/s10557-012-6427-8.
• [54] Expression profiling of the estrogen responsive genes in response to phytoestrogens using a customized DNA microarray. FEBS Lett. 2005 Mar 14;579(7):1732-40.
• [55] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [56] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [57] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [58] Identification of formaldehyde-responsive genes by suppression subtractive hybridization. Toxicology. 2008 Jan 14;243(1-2):224-35.
• [59] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [60] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
• [61] Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.