Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAW0V4V)

DOT Name	Apoptosis regulator BAX (BAX)
Synonyms	Bcl-2-like protein 4; Bcl2-L-4
Gene Name	BAX
Related Disease	Leukemia, acute lymphocytic, susceptibility to, 1 ( )
UniProt ID	BAX_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1F16; 2G5B; 2K7W; 2LR1; 3PK1; 3PL7; 4BD2; 4BD6; 4BD7; 4BD8; 4BDU; 4S0O; 4S0P; 4UF2; 4ZIE; 4ZIF; 4ZIG; 4ZIH; 4ZII; 5W5X; 5W5Z; 5W60; 5W61; 6EB6; 6L8V; 6L95; 6TRR; 6XY6; 7ADT
Pfam ID	PF00452
Sequence	MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV LTASLTIWKKMG
Function	Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.
Tissue Specificity	Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.
KEGG Pathway	EGFR tyrosine ki.se inhibitor resistance (hsa01521 ) Endocrine resistance (hsa01522 ) Platinum drug resistance (hsa01524 ) Sphingolipid sig.ling pathway (hsa04071 ) p53 sig.ling pathway (hsa04115 ) Protein processing in endoplasmic reticulum (hsa04141 ) Apoptosis (hsa04210 ) Longevity regulating pathway (hsa04211 ) Apoptosis - multiple species (hsa04215 ) Necroptosis (hsa04217 ) Neurotrophin sig.ling pathway (hsa04722 ) Non-alcoholic fatty liver disease (hsa04932 ) AGE-RAGE sig.ling pathway in diabetic complications (hsa04933 ) Parkinson disease (hsa05012 ) Amyotrophic lateral sclerosis (hsa05014 ) Huntington disease (hsa05016 ) Prion disease (hsa05020 ) Pathways of neurodegeneration - multiple diseases (hsa05022 ) Pathogenic Escherichia coli infection (hsa05130 ) Shigellosis (hsa05131 ) Salmonella infection (hsa05132 ) Tuberculosis (hsa05152 ) Hepatitis C (hsa05160 ) Hepatitis B (hsa05161 ) Measles (hsa05162 ) Human cytomegalovirus infection (hsa05163 ) Influenza A (hsa05164 ) Human papillomavirus infection (hsa05165 ) Human T-cell leukemia virus 1 infection (hsa05166 ) Kaposi sarcoma-associated herpesvirus infection (hsa05167 ) Herpes simplex virus 1 infection (hsa05168 ) Epstein-Barr virus infection (hsa05169 ) Human immunodeficiency virus 1 infection (hsa05170 ) Pathways in cancer (hsa05200 ) Transcriptio.l misregulation in cancer (hsa05202 ) Viral carcinogenesis (hsa05203 ) Colorectal cancer (hsa05210 ) Pancreatic cancer (hsa05212 ) Endometrial cancer (hsa05213 ) Glioma (hsa05214 ) Thyroid cancer (hsa05216 ) Basal cell carcinoma (hsa05217 ) Melanoma (hsa05218 ) Chronic myeloid leukemia (hsa05220 ) Small cell lung cancer (hsa05222 ) Non-small cell lung cancer (hsa05223 ) Breast cancer (hsa05224 ) Hepatocellular carcinoma (hsa05225 ) Gastric cancer (hsa05226 ) Lipid and atherosclerosis (hsa05417 )
Reactome Pathway	Activation, translocation and oligomerization of BAX (R-HSA-114294 ) Pyroptosis (R-HSA-5620971 ) TP53 Regulates Transcription of Genes Involved in Cytochrome C Release (R-HSA-6803204 ) TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest (R-HSA-6804114 ) Transcriptional regulation by RUNX2 (R-HSA-8878166 ) NTRK3 as a dependence receptor (R-HSA-9603505 ) Release of apoptotic factors from the mitochondria (R-HSA-111457 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Leukemia, acute lymphocytic, susceptibility to, 1	DIS3KSMM	Limited	Unknown	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Sulindac	DM2QHZU	Approved	Apoptosis regulator BAX (BAX) increases the response to substance of Sulindac.	[94]
Amsacrine	DMZKYIV	Approved	Apoptosis regulator BAX (BAX) increases the response to substance of Amsacrine.	[95]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Apoptosis regulator BAX (BAX).	[2]
------------------------------------------------------------------------------------

96 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Apoptosis regulator BAX (BAX).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Apoptosis regulator BAX (BAX).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Apoptosis regulator BAX (BAX).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Apoptosis regulator BAX (BAX).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Apoptosis regulator BAX (BAX).	[7]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Apoptosis regulator BAX (BAX).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Apoptosis regulator BAX (BAX).	[9]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Apoptosis regulator BAX (BAX).	[10]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Apoptosis regulator BAX (BAX).	[11]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Apoptosis regulator BAX (BAX).	[12]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Apoptosis regulator BAX (BAX).	[13]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Apoptosis regulator BAX (BAX).	[14]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Apoptosis regulator BAX (BAX).	[15]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Apoptosis regulator BAX (BAX).	[16]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Apoptosis regulator BAX (BAX).	[17]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Apoptosis regulator BAX (BAX).	[18]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Apoptosis regulator BAX (BAX).	[19]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Apoptosis regulator BAX (BAX).	[20]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Apoptosis regulator BAX (BAX).	[21]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Apoptosis regulator BAX (BAX).	[22]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Apoptosis regulator BAX (BAX).	[23]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Apoptosis regulator BAX (BAX).	[24]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Apoptosis regulator BAX (BAX).	[7]
Folic acid	DMEMBJC	Approved	Folic acid affects the expression of Apoptosis regulator BAX (BAX).	[25]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Apoptosis regulator BAX (BAX).	[26]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Apoptosis regulator BAX (BAX).	[27]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Apoptosis regulator BAX (BAX).	[28]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Apoptosis regulator BAX (BAX).	[29]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Apoptosis regulator BAX (BAX).	[30]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Apoptosis regulator BAX (BAX).	[31]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Apoptosis regulator BAX (BAX).	[32]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Apoptosis regulator BAX (BAX).	[33]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Apoptosis regulator BAX (BAX).	[34]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Apoptosis regulator BAX (BAX).	[35]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Apoptosis regulator BAX (BAX).	[36]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Apoptosis regulator BAX (BAX).	[37]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of Apoptosis regulator BAX (BAX).	[38]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Apoptosis regulator BAX (BAX).	[39]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Apoptosis regulator BAX (BAX).	[40]
DTI-015	DMXZRW0	Approved	DTI-015 increases the expression of Apoptosis regulator BAX (BAX).	[41]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Apoptosis regulator BAX (BAX).	[42]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Apoptosis regulator BAX (BAX).	[38]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of Apoptosis regulator BAX (BAX).	[43]
Mitomycin	DMH0ZJE	Approved	Mitomycin decreases the expression of Apoptosis regulator BAX (BAX).	[44]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Apoptosis regulator BAX (BAX).	[45]
Cocaine	DMSOX7I	Approved	Cocaine increases the expression of Apoptosis regulator BAX (BAX).	[46]
Simvastatin	DM30SGU	Approved	Simvastatin increases the expression of Apoptosis regulator BAX (BAX).	[47]
Topotecan	DMP6G8T	Approved	Topotecan increases the expression of Apoptosis regulator BAX (BAX).	[48]
Rifampicin	DM5DSFZ	Approved	Rifampicin decreases the expression of Apoptosis regulator BAX (BAX).	[49]
Mitoxantrone	DMM39BF	Approved	Mitoxantrone increases the expression of Apoptosis regulator BAX (BAX).	[50]
Mifepristone	DMGZQEF	Approved	Mifepristone increases the expression of Apoptosis regulator BAX (BAX).	[51]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Apoptosis regulator BAX (BAX).	[45]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Apoptosis regulator BAX (BAX).	[45]
Capsaicin	DMGMF6V	Approved	Capsaicin increases the expression of Apoptosis regulator BAX (BAX).	[52]
Alitretinoin	DMME8LH	Approved	Alitretinoin increases the expression of Apoptosis regulator BAX (BAX).	[53]
Methamphetamine	DMPM4SK	Approved	Methamphetamine increases the expression of Apoptosis regulator BAX (BAX).	[54]
Daunorubicin	DMQUSBT	Approved	Daunorubicin increases the expression of Apoptosis regulator BAX (BAX).	[50]
Acocantherin	DM7JT24	Approved	Acocantherin increases the expression of Apoptosis regulator BAX (BAX).	[55]
Liothyronine	DM6IR3P	Approved	Liothyronine decreases the expression of Apoptosis regulator BAX (BAX).	[56]
Lindane	DMB8CNL	Approved	Lindane increases the expression of Apoptosis regulator BAX (BAX).	[57]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of Apoptosis regulator BAX (BAX).	[26]
Colchicine	DM2POTE	Approved	Colchicine increases the expression of Apoptosis regulator BAX (BAX).	[58]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea increases the expression of Apoptosis regulator BAX (BAX).	[59]
Ursodeoxycholic acid	DMCUT21	Approved	Ursodeoxycholic acid increases the expression of Apoptosis regulator BAX (BAX).	[61]
Beta-carotene	DM0RXBT	Approved	Beta-carotene decreases the expression of Apoptosis regulator BAX (BAX).	[62]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil increases the expression of Apoptosis regulator BAX (BAX).	[45]
Imatinib	DM7RJXL	Approved	Imatinib increases the expression of Apoptosis regulator BAX (BAX).	[63]
Dactinomycin	DM2YGNW	Approved	Dactinomycin increases the expression of Apoptosis regulator BAX (BAX).	[64]
Docetaxel	DMDI269	Approved	Docetaxel increases the expression of Apoptosis regulator BAX (BAX).	[7]
Cholecalciferol	DMGU74E	Approved	Cholecalciferol increases the expression of Apoptosis regulator BAX (BAX).	[65]
Dopamine	DMPGUCF	Approved	Dopamine decreases the expression of Apoptosis regulator BAX (BAX).	[66]
Isoproterenol	DMK7MEY	Approved	Isoproterenol decreases the expression of Apoptosis regulator BAX (BAX).	[67]
Lovastatin	DM9OZWQ	Approved	Lovastatin increases the expression of Apoptosis regulator BAX (BAX).	[68]
Ardeparin	DMYRX8B	Approved	Ardeparin increases the expression of Apoptosis regulator BAX (BAX).	[69]
Propofol	DMB4OLE	Approved	Propofol increases the expression of Apoptosis regulator BAX (BAX).	[70]
Melatonin	DMKWFBT	Approved	Melatonin increases the expression of Apoptosis regulator BAX (BAX).	[71]
Artesunate	DMR27C8	Approved	Artesunate increases the expression of Apoptosis regulator BAX (BAX).	[72]
Sevoflurane	DMC9O43	Approved	Sevoflurane increases the expression of Apoptosis regulator BAX (BAX).	[73]
Isoniazid	DM5JVS3	Approved	Isoniazid increases the expression of Apoptosis regulator BAX (BAX).	[74]
Morphine	DMRMS0L	Approved	Morphine increases the expression of Apoptosis regulator BAX (BAX).	[76]
Glutathione	DMAHMT9	Approved	Glutathione increases the expression of Apoptosis regulator BAX (BAX).	[77]
Eicosapentaenoic acid/docosa-hexaenoic acid	DMMUCG4	Approved	Eicosapentaenoic acid/docosa-hexaenoic acid increases the expression of Apoptosis regulator BAX (BAX).	[78]
2-deoxyglucose	DMIAHVU	Approved	2-deoxyglucose decreases the expression of Apoptosis regulator BAX (BAX).	[79]
Tacrolimus	DMZ7XNQ	Approved	Tacrolimus increases the expression of Apoptosis regulator BAX (BAX).	[80]
Ciprofloxacin XR	DM2NLS9	Approved	Ciprofloxacin XR increases the expression of Apoptosis regulator BAX (BAX).	[81]
Cantharidin	DMBP5N3	Approved	Cantharidin increases the expression of Apoptosis regulator BAX (BAX).	[82]
Cimetidine	DMH61ZB	Approved	Cimetidine increases the expression of Apoptosis regulator BAX (BAX).	[83]
Hesperetin	DMKER83	Approved	Hesperetin increases the expression of Apoptosis regulator BAX (BAX).	[84]
Lapatinib	DM3BH1Y	Approved	Lapatinib increases the expression of Apoptosis regulator BAX (BAX).	[85]
Chlorambucil	DMRKE63	Approved	Chlorambucil increases the expression of Apoptosis regulator BAX (BAX).	[86]
Propranolol	DM79NTF	Approved	Propranolol increases the expression of Apoptosis regulator BAX (BAX).	[87]
Amodiaquine	DME4RA8	Approved	Amodiaquine increases the expression of Apoptosis regulator BAX (BAX).	[89]
Masoprocol	DMMVNZ0	Approved	Masoprocol increases the expression of Apoptosis regulator BAX (BAX).	[90]
Phenylephrine	DMZHUO5	Approved	Phenylephrine increases the expression of Apoptosis regulator BAX (BAX).	[91]
Nicotinamide	DMUPE07	Approved	Nicotinamide increases the expression of Apoptosis regulator BAX (BAX).	[92]
LY2835219	DM93VBZ	Approved	LY2835219 affects the expression of Apoptosis regulator BAX (BAX).	[93]
------------------------------------------------------------------------------------


⏷ Show the Full List of 96 Drug(s)

3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Sorafenib	DMS8IFC	Approved	Sorafenib increases the cleavage of Apoptosis regulator BAX (BAX).	[60]
Adenosine	DMM2NSK	Approved	Adenosine increases the localization of Apoptosis regulator BAX (BAX).	[75]
Sulfasalazine	DMICA9H	Approved	Sulfasalazine affects the localization of Apoptosis regulator BAX (BAX).	[88]
------------------------------------------------------------------------------------

References

1	Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
4	Real-time PCR analysis of the apoptosis related genes in ATRA treated APL t(15;17) patients. Exp Mol Med. 2003 Oct 31;35(5):454-9. doi: 10.1038/emm.2003.59.
5	Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
6	Response rate of fibrosarcoma cells to cytotoxic drugs on the expression level correlates to the therapeutic response rate of fibrosarcomas and is mediated by regulation of apoptotic pathways. BMC Cancer. 2005 Jul 7;5:74. doi: 10.1186/1471-2407-5-74.
7	Enhanced Bax in oral SCC in relation to antitumor effects of chemotherapy. J Oral Pathol Med. 2005 Feb;34(2):93-9. doi: 10.1111/j.1600-0714.2004.00257.x.
8	(4-Picolylamino)-17-Estradiol derivative and analogues induce apoptosis with death receptor trail R2/DR5 in MCF-7. Chem Biol Interact. 2023 Jan 5;369:110286. doi: 10.1016/j.cbi.2022.110286. Epub 2022 Nov 29.
9	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10	Inorganic arsenic exposure increased expression of Fas and Bax gene in vivo and vitro. Gene. 2018 Sep 10;671:135-141. doi: 10.1016/j.gene.2018.05.121. Epub 2018 Jun 1.
11	Responses of human lens epithelial cells to quercetin and DMSO. Invest Ophthalmol Vis Sci. 2007 Aug;48(8):3714-8. doi: 10.1167/iovs.06-1304.
12	Verapamil potentiates anti-glioblastoma efficacy of temozolomide by modulating apoptotic signaling. Toxicol In Vitro. 2018 Oct;52:306-313. doi: 10.1016/j.tiv.2018.07.001. Epub 2018 Jul 9.
13	Arsenic trioxide (As(2)O(3)) induced apoptosis and its mechanisms in a human esophageal squamous carcinoma cell line. Chin Med J (Engl). 2002 Feb;115(2):280-5.
14	Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
15	Effects of 25-hydroxyvitamin D(3) on proliferation and osteoblast differentiation of human marrow stromal cells require CYP27B1/1alpha-hydroxylase. J Bone Miner Res. 2011 May;26(5):1145-53.
16	Suberoylanilide hydroxamic acid (Zolinza/vorinostat) sensitizes TRAIL-resistant breast cancer cells orthotopically implanted in BALB/c nude mice. Mol Cancer Ther. 2009 Jun;8(6):1596-605. doi: 10.1158/1535-7163.MCT-08-1004. Epub 2009 Jun 9.
17	Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
18	Methoxychlor and triclosan stimulates ovarian cancer growth by regulating cell cycle- and apoptosis-related genes via an estrogen receptor-dependent pathway. Environ Toxicol Pharmacol. 2014 May;37(3):1264-74. doi: 10.1016/j.etap.2014.04.013. Epub 2014 Apr 18.
19	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
20	Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
21	Downmodulation of dimethyl transferase activity enhances tumor necrosis factor-related apoptosis-inducing ligand-induced apoptosis in prostate cancer cells. Int J Oncol. 2008 Aug;33(2):381-8.
22	Gene expression changes in human small airway epithelial cells exposed to Delta9-tetrahydrocannabinol. Toxicol Lett. 2005 Aug 14;158(2):95-107.
23	Effect of zoledronic acid on oral fibroblasts and epithelial cells: a potential mechanism of bisphosphonate-associated osteonecrosis. Br J Haematol. 2009 Mar;144(5):667-76. doi: 10.1111/j.1365-2141.2008.07504.x. Epub 2008 Nov 20.
24	Modulation of notch signaling pathway to prevent H2O2/menadione-induced SK-N-MC cells death by EUK134. Cell Mol Neurobiol. 2014 Oct;34(7):1037-45. doi: 10.1007/s10571-014-0079-0. Epub 2014 Jul 9.
25	Effects of folate deficiency on gene expression in the apoptosis and cancer pathways in colon cancer cells. Carcinogenesis. 2006 May;27(5):916-24. doi: 10.1093/carcin/bgi312. Epub 2005 Dec 16.
26	Niclosamide and Bicalutamide Combination Treatment Overcomes Enzalutamide- and Bicalutamide-Resistant Prostate Cancer. Mol Cancer Ther. 2017 Aug;16(8):1521-1530. doi: 10.1158/1535-7163.MCT-16-0912. Epub 2017 May 12.
27	Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
28	[Receptor-related mechanism of proliferation inhibilion and apoptosis induetion of human tongue squamous cell line Tca8113 by retinoids]. Di Yi Jun Yi Da Xue Xue Bao. 2005 Aug;25(8):935-41.
29	Bortezomib induces apoptosis in human neuroblastoma CHP126 cells. Pharmazie. 2010 Mar;65(3):213-8.
30	Effect of ligand troglitazone on peroxisome proliferator-activated receptor gamma expression and cellular growth in human colon cancer cells. World J Gastroenterol. 2006 Dec 7;12(45):7263-70. doi: 10.3748/wjg.v12.i45.7263.
31	Hydroquinone-induced malignant transformation of TK6 cells by facilitating SIRT1-mediated p53 degradation and up-regulating KRAS. Toxicol Lett. 2016 Sep 30;259:133-142. doi: 10.1016/j.toxlet.2016.08.006. Epub 2016 Aug 8.
32	Rosiglitazone sensitizes MDA-MB-231 breast cancer cells to anti-tumour effects of tumour necrosis factor-alpha, CH11 and CYC202. Endocr Relat Cancer. 2007 Jun;14(2):305-15. doi: 10.1677/ERC-06-0003.
33	Prenatal ethanol exposure-induced a low level of foetal blood cholesterol and its mechanism of IGF1-related placental cholesterol transport dysfunction. Toxicology. 2019 Aug 1;424:152237. doi: 10.1016/j.tox.2019.152237. Epub 2019 Jun 18.
34	Differential p53 phosphorylation and activation of apoptosis-promoting genes Bax and Fas/APO-1 by irradiation and ara-C treatment. Cell Death Differ. 1998 Jul;5(7):584-91. doi: 10.1038/sj.cdd.4400382.
35	Lunasin, a novel seed peptide, sensitizes human breast cancer MDA-MB-231 cells to aspirin-arrested cell cycle and induced apoptosis. Chem Biol Interact. 2010 Jul 30;186(2):127-34. doi: 10.1016/j.cbi.2010.04.027. Epub 2010 May 21.
36	Responses of genes involved in cell cycle control to diverse DNA damaging chemicals in human lung adenocarcinoma A549 cells. Cancer Cell Int. 2005 Aug 24;5:28. doi: 10.1186/1475-2867-5-28.
37	Susceptibility to drug-induced apoptosis correlates with differential modulation of Bad, Bcl-2 and Bcl-xL protein levels. Cell Death Differ. 2000 Jun;7(6):574-86. doi: 10.1038/sj.cdd.4400688.
38	Development of an alternative zebrafish model for drug-induced intestinal toxicity. J Appl Toxicol. 2018 Feb;38(2):259-273. doi: 10.1002/jat.3520. Epub 2017 Oct 13.
39	Activation of 5-lipoxygenase is required for nicotine mediated epithelial-mesenchymal transition and tumor cell growth. Cancer Lett. 2010 Jun 28;292(2):237-45.
40	Clozapine induces oxidative stress and proapoptotic gene expression in neutrophils of schizophrenic patients. J Clin Psychopharmacol. 2005 Oct;25(5):419-26. doi: 10.1097/01.jcp.0000177668.42640.fe.
41	Elevated expression of Dickkopf-1 increases the sensitivity of human glioma cell line SHG44 to BCNU. J Exp Clin Cancer Res. 2010 Oct 4;29(1):131. doi: 10.1186/1756-9966-29-131.
42	The protective effects of the antioxidant N-acetylcysteine (NAC) against oxidative stress-associated apoptosis evoked by the organophosphorus insecticide malathion in normal human astrocytes. Toxicology. 2019 Apr 1;417:1-14.
43	Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
44	The growth-inhibition effect of tamoxifen in the combination chemotherapeutics on the human cholangiocarcinoma cell line QBC939. Mol Biol Rep. 2010 Jul;37(6):2693-701. doi: 10.1007/s11033-009-9801-2. Epub 2009 Sep 13.
45	Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
46	Gene expression profiling reveals distinct cocaine-responsive genes in human fetal CNS cell types. J Addict Med. 2009 Dec;3(4):218-26. doi: 10.1097/ADM.0b013e318199d863.
47	Inhibition of Barret's adenocarcinoma cell growth by simvastatin: involvement of COX-2 and apoptosis-related proteins. J Physiol Pharmacol. 2007 Aug;58 Suppl 3:141-8.
48	p63 involvement in poly(ADP-ribose) polymerase 1 signaling of topoisomerase I-dependent DNA damage in carcinoma cells. Biochem Pharmacol. 2013 Apr 1;85(7):999-1006. doi: 10.1016/j.bcp.2013.01.019. Epub 2013 Jan 29.
49	Rifampicin inhibits CD95-mediated apoptosis of Jurkat T cells via glucocorticoid receptors by modifying the expression of molecules regulating apoptosis. J Clin Immunol. 2002 Jan;22(1):37-47. doi: 10.1023/a:1014256603539.
50	Identification of genomic biomarkers for anthracycline-induced cardiotoxicity in human iPSC-derived cardiomyocytes: an in vitro repeated exposure toxicity approach for safety assessment. Arch Toxicol. 2016 Nov;90(11):2763-2777.
51	Effect of mifepristone on proliferation and apoptosis of Ishikawa endometrial adenocarcinoma cells. Fertil Steril. 2005 Jul;84(1):202-11. doi: 10.1016/j.fertnstert.2005.01.126.
52	TRPV6 mediates capsaicin-induced apoptosis in gastric cancer cells--Mechanisms behind a possible new "hot" cancer treatment. Biochim Biophys Acta. 2007 Apr;1773(4):565-76. doi: 10.1016/j.bbamcr.2007.01.001. Epub 2007 Jan 10.
53	Retinoids cause apoptosis in pancreatic cancer cells via activation of RAR-gamma and altered expression of Bcl-2/Bax. Br J Cancer. 2002 Aug 27;87(5):555-61. doi: 10.1038/sj.bjc.6600496.
54	An insight into the hepatocellular death induced by amphetamines, individually and in combination: the involvement of necrosis and apoptosis. Arch Toxicol. 2013 Dec;87(12):2165-85. doi: 10.1007/s00204-013-1082-9. Epub 2013 Jul 3.
55	[Ouabain-induced apoptosis of Jurkat cells correlates with activation of caspase-3 and regulation of Bcl-2 gene family]. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2006 Oct;14(5):891-4.
56	3,5,3'-triiodothyronine (T3) is a survival factor for pancreatic beta-cells undergoing apoptosis. J Cell Physiol. 2006 Feb;206(2):309-21. doi: 10.1002/jcp.20460.
57	Low dose induction of micronuclei by lindane. Carcinogenesis. 2004 Apr;25(4):613-22. doi: 10.1093/carcin/bgh048. Epub 2003 Dec 19.
58	Colchicine-induced apoptosis in human normal liver L-02 cells by mitochondrial mediated pathways. Toxicol In Vitro. 2012 Aug;26(5):649-55. doi: 10.1016/j.tiv.2012.01.024. Epub 2012 Feb 8.
59	Hydroxyurea (HU)-induced apoptosis in the mouse fetal lung. Exp Mol Pathol. 2005 Aug;79(1):59-67. doi: 10.1016/j.yexmp.2005.02.007. Epub 2005 Apr 22.
60	Apoptosis induced by the kinase inhibitor BAY 43-9006 in human leukemia cells involves down-regulation of Mcl-1 through inhibition of translation. J Biol Chem. 2005 Oct 21;280(42):35217-27. doi: 10.1074/jbc.M506551200. Epub 2005 Aug 18.
61	Mechanism of apoptotic effects induced selectively by ursodeoxycholic acid on human hepatoma cell lines. World J Gastroenterol. 2007 Mar 21;13(11):1652-8. doi: 10.3748/wjg.v13.i11.1652.
62	Beta-carotene and apocarotenals promote retinoid signaling in BEAS-2B human bronchioepithelial cells. Arch Biochem Biophys. 2006 Nov 1;455(1):48-60.
63	Saikosaponin D disrupts platelet-derived growth factor- receptor/p38 pathway leading to mitochondrial apoptosis in human LO2 hepatocyte cells: a potential mechanism of hepatotoxicity. Chem Biol Interact. 2013 Oct 25;206(1):76-82. doi: 10.1016/j.cbi.2013.08.006. Epub 2013 Aug 28.
64	Genomic profiling uncovers a molecular pattern for toxicological characterization of mutagens and promutagens in vitro. Toxicol Sci. 2011 Jul;122(1):185-97.
65	Vitamin D ameliorates diethylnitrosamine-induced liver preneoplasia: A pivotal role of CYP3A4/CYP2E1 via DPP-4 enzyme inhibition. Toxicol Appl Pharmacol. 2023 Jan 1;458:116324. doi: 10.1016/j.taap.2022.116324. Epub 2022 Nov 25.
66	Effects of dopamine on LC3-II activation as a marker of autophagy in a neuroblastoma cell model. Neurotoxicology. 2009 Jul;30(4):658-65. doi: 10.1016/j.neuro.2009.04.007. Epub 2009 May 4.
67	Isoproterenol effects evaluated in heart slices of human and rat in comparison to rat heart in vivo. Toxicol Appl Pharmacol. 2014 Jan 15;274(2):302-12.
68	Lovastatin augments apoptosis induced by chemotherapeutic agents in colon cancer cells. Clin Cancer Res. 1999 Aug;5(8):2223-9.
69	Effect of heparin on apoptosis in human nasopharyngeal carcinoma CNE2 cells. Cell Res. 2001 Dec;11(4):311-5. doi: 10.1038/sj.cr.7290101.
70	Evaluation of cytotoxicity of propofol and its related mechanism in glioblastoma cells and astrocytes. Environ Toxicol. 2017 Dec;32(12):2440-2454.
71	Melatonin increases the anticancer potential of doxorubicin in Caco-2 colorectal cancer cells. Environ Toxicol. 2021 Jun;36(6):1061-1069. doi: 10.1002/tox.23105. Epub 2021 Jan 28.
72	Artesunate induces apoptosis through caspase-dependent and -independent mitochondrial pathways in human myelodysplastic syndrome SKM-1 cells. Chem Biol Interact. 2014 Aug 5;219:28-36. doi: 10.1016/j.cbi.2014.03.011. Epub 2014 Apr 3.
73	4.8% sevoflurane induces activation of autophagy in human neuroblastoma SH-SY5Y cells by the AMPK/mTOR signaling pathway. Neurotoxicology. 2022 May;90:256-264. doi: 10.1016/j.neuro.2022.04.008. Epub 2022 Apr 23.
74	Quercetin protected against isoniazide-induced HepG2 cell apoptosis by activating the SIRT1/ERK pathway. J Biochem Mol Toxicol. 2019 Sep;33(9):e22369. doi: 10.1002/jbt.22369. Epub 2019 Jul 23.
75	Thymidine-dependent attenuation of the mitochondrial apoptotic pathway in adenosine-induced apoptosis of HL-60 cells. J Cancer Res Clin Oncol. 2001 Sep;127(9):570-6. doi: 10.1007/s004320100264.
76	Morphine promotes apoptosis in Jurkat cells. J Leukoc Biol. 1999 Oct;66(4):650-8. doi: 10.1002/jlb.66.4.650.
77	Apoptosis induced by extracellular glutathione is mediated by H(2)O(2) production and DNA damage. Int J Cancer. 2000 Aug 1;87(3):343-8. doi: 10.1002/1097-0215(20000801)87:3<343::aid-ijc6>3.0.co;2-8.
78	The effect of combination treatment with docosahexaenoic acid and 5-fluorouracil on the mRNA expression of apoptosis-related genes, including the novel gene BCL2L12, in gastric cancer cells. In Vitro Cell Dev Biol Anim. 2009 Jan-Feb;45(1-2):69-74. doi: 10.1007/s11626-008-9154-5. Epub 2008 Nov 18.
79	Cytotoxic effects of mithramycin DIG-MSK can depend on the rise of autophagy. Toxicol In Vitro. 2015 Oct;29(7):1537-44. doi: 10.1016/j.tiv.2015.06.008. Epub 2015 Jun 13.
80	Immunosuppressive calcineurin inhibitor cyclosporine A?induces proapoptotic endoplasmic reticulum stress in renal tubular cells. J Biol Chem. 2022 Mar;298(3):101589. doi: 10.1016/j.jbc.2022.101589. Epub 2022 Jan 14.
81	Ciprofloxacin mediated cell growth inhibition, S/G2-M cell cycle arrest, and apoptosis in a human transitional cell carcinoma of the bladder cell line. Clin Cancer Res. 2000 Mar;6(3):891-900.
82	[Apoptosis induced by cantharidin in human pulmonary carcinoma cells A549 and its molecular mechanisms]. Zhonghua Zhong Liu Za Zhi. 2005 Jun;27(6):330-4.
83	Cimetidine induces apoptosis in gastric cancer cells in vitro and inhibits tumor growth in vivo. Oncol Rep. 2010 Mar;23(3):693-700. doi: 10.3892/or_00000686.
84	Hesperetin inhibit adipocyte differentiation and enhance Bax- and p21-mediated adipolysis in human mesenchymal stem cell adipogenesis. J Biochem Mol Toxicol. 2015 Mar;29(3):99-108. doi: 10.1002/jbt.21672. Epub 2014 Oct 26.
85	Effects of lapatinib on cell proliferation and apoptosis in NB4 cells. Oncol Lett. 2018 Jan;15(1):235-242. doi: 10.3892/ol.2017.7342. Epub 2017 Nov 3.
86	Bcl-2 antisense oligonucleotides enhance the cytotoxicity of chlorambucil in B-cell chronic lymphocytic leukaemia cells. Leuk Lymphoma. 2001 Jul;42(3):491-8. doi: 10.3109/10428190109064606.
87	Propranolol inhibits proliferation and induces apoptosis of hemangioma-derived endothelial cells via Akt pathway by down-regulating Ang-2 expression. Chem Biol Interact. 2020 Jan 25;316:108925. doi: 10.1016/j.cbi.2019.108925. Epub 2019 Dec 12.
88	Molecular mechanisms of sulfasalazine-induced T-cell apoptosis. Br J Pharmacol. 2002 Nov;137(5):608-20. doi: 10.1038/sj.bjp.0704870.
89	Apoptosis contributes to the cytotoxicity induced by amodiaquine and its major metabolite N-desethylamodiaquine in hepatic cells. Toxicol In Vitro. 2020 Feb;62:104669. doi: 10.1016/j.tiv.2019.104669. Epub 2019 Oct 16.
90	Inhibition of AP-1 transcription activator induces myc-dependent apoptosis in HL60 cells. J Cell Biochem. 2004 Apr 1;91(5):973-86. doi: 10.1002/jcb.10768.
91	Phenylephrine induces necroptosis and apoptosis in corneal epithelial cells dose- and time-dependently. Toxicology. 2019 Dec 1;428:152305. doi: 10.1016/j.tox.2019.152305. Epub 2019 Oct 9.
92	SIRT1 interacts with p73 and suppresses p73-dependent transcriptional activity. J Cell Physiol. 2007 Jan;210(1):161-6. doi: 10.1002/jcp.20831.
93	In vitro therapeutic effects of abemaciclib on triple-negative breast cancer cells. J Biochem Mol Toxicol. 2021 Sep;35(9):e22858. doi: 10.1002/jbt.22858. Epub 2021 Jul 26.
94	Role of BAX in the apoptotic response to anticancer agents. Science. 2000 Nov 3;290(5493):989-92. doi: 10.1126/science.290.5493.989.
95	Acridine derivatives activate p53 and induce tumor cell death through Bax. Cancer Biol Ther. 2005 Aug;4(8):893-8. doi: 10.4161/cbt.4.8.2134.