Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCYKGKO)

• DOT Name: Mitogen-activated protein kinase 3 (MAPK3)
• Synonyms: MAP kinase 3; MAPK 3; EC 2.7.11.24; ERT2; Extracellular signal-regulated kinase 1; ERK-1; Insulin-stimulated MAP2 kinase; MAP kinase isoform p44; p44-MAPK; Microtubule-associated protein 2 kinase; p44-ERK1
• Gene Name: MAPK3
• UniProt ID: MK03_HUMAN
• PDB ID: 2ZOQ; 4QTB; 6GES
• EC Number: 2.7.11.24
• Pfam ID: PF00069
• Sequence:
  MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
  DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
  VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
  KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
  NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
  SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
  KELIFQETARFQPGVLEAP
• Function: Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade also plays a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, DEPTOR, FRS2 or GRB10). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade.
• KEGG Pathway:
  EGFR tyrosine ki.se inhibitor resistance (hsa01521)
  Endocrine resistance (hsa01522)
  Platinum drug resistance (hsa01524)
  MAPK sig.ling pathway (hsa04010)
  ErbB sig.ling pathway (hsa04012)
  Ras sig.ling pathway (hsa04014)
  Rap1 sig.ling pathway (hsa04015)
  cGMP-PKG sig.ling pathway (hsa04022)
  cAMP sig.ling pathway (hsa04024)
  Chemokine sig.ling pathway (hsa04062)
  HIF-1 sig.ling pathway (hsa04066)
  FoxO sig.ling pathway (hsa04068)
  Sphingolipid sig.ling pathway (hsa04071)
  Phospholipase D sig.ling pathway (hsa04072)
  Oocyte meiosis (hsa04114)
  Autophagy - animal (hsa04140)
  Efferocytosis (hsa04148)
  mTOR sig.ling pathway (hsa04150)
  PI3K-Akt sig.ling pathway (hsa04151)
  Apoptosis (hsa04210)
  Cellular senescence (hsa04218)
  Adrenergic sig.ling in cardiomyocytes (hsa04261)
  Vascular smooth muscle contraction (hsa04270)
  TGF-beta sig.ling pathway (hsa04350)
  Axon guidance (hsa04360)
  VEGF sig.ling pathway (hsa04370)
  Apelin sig.ling pathway (hsa04371)
  Osteoclast differentiation (hsa04380)
  Focal adhesion (hsa04510)
  Adherens junction (hsa04520)
  Gap junction (hsa04540)
  Sig.ling pathways regulating pluripotency of stem cells (hsa04550)
  Platelet activation (hsa04611)
  Neutrophil extracellular trap formation (hsa04613)
  Toll-like receptor sig.ling pathway (hsa04620)
  NOD-like receptor sig.ling pathway (hsa04621)
  C-type lectin receptor sig.ling pathway (hsa04625)
  .tural killer cell mediated cytotoxicity (hsa04650)
  IL-17 sig.ling pathway (hsa04657)
  Th1 and Th2 cell differentiation (hsa04658)
  Th17 cell differentiation (hsa04659)
  T cell receptor sig.ling pathway (hsa04660)
  B cell receptor sig.ling pathway (hsa04662)
  Fc epsilon RI sig.ling pathway (hsa04664)
  Fc gamma R-mediated phagocytosis (hsa04666)
  TNF sig.ling pathway (hsa04668)
  Circadian entrainment (hsa04713)
  Long-term potentiation (hsa04720)
  Neurotrophin sig.ling pathway (hsa04722)
  Retrograde endocan.binoid sig.ling (hsa04723)
  Glutamatergic sy.pse (hsa04724)
  Cholinergic sy.pse (hsa04725)
  Serotonergic sy.pse (hsa04726)
  Long-term depression (hsa04730)
  Regulation of actin cytoskeleton (hsa04810)
  Insulin sig.ling pathway (hsa04910)
  GnRH sig.ling pathway (hsa04912)
  Progesterone-mediated oocyte maturation (hsa04914)
  Estrogen sig.ling pathway (hsa04915)
  Melanogenesis (hsa04916)
  Prolactin sig.ling pathway (hsa04917)
  Thyroid hormone sig.ling pathway (hsa04919)
  Oxytocin sig.ling pathway (hsa04921)
  Relaxin sig.ling pathway (hsa04926)
  Parathyroid hormone synthesis, secretion and action (hsa04928)
  GnRH secretion (hsa04929)
  Type II diabetes mellitus (hsa04930)
  AGE-RAGE sig.ling pathway in diabetic complications (hsa04933)
  Cushing syndrome (hsa04934)
  Growth hormone synthesis, secretion and action (hsa04935)
  Aldosterone-regulated sodium reabsorption (hsa04960)
  Alzheimer disease (hsa05010)
  Prion disease (hsa05020)
  Pathways of neurodegeneration - multiple diseases (hsa05022)
  Alcoholism (hsa05034)
  Pathogenic Escherichia coli infection (hsa05130)
  Shigellosis (hsa05131)
  Salmonella infection (hsa05132)
  Pertussis (hsa05133)
  Yersinia infection (hsa05135)
  Leishmaniasis (hsa05140)
  Chagas disease (hsa05142)
  Toxoplasmosis (hsa05145)
  Tuberculosis (hsa05152)
  Hepatitis C (hsa05160)
  Hepatitis B (hsa05161)
  Human cytomegalovirus infection (hsa05163)
  Influenza A (hsa05164)
  Human papillomavirus infection (hsa05165)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
  Human immunodeficiency virus 1 infection (hsa05170)
  Coro.virus disease - COVID-19 (hsa05171)
  Pathways in cancer (hsa05200)
  Viral carcinogenesis (hsa05203)
  Proteoglycans in cancer (hsa05205)
  MicroR.s in cancer (hsa05206)
  Chemical carcinogenesis - receptor activation (hsa05207)
  Chemical carcinogenesis - reactive oxygen species (hsa05208)
  Colorectal cancer (hsa05210)
  Re.l cell carcinoma (hsa05211)
  Pancreatic cancer (hsa05212)
  Endometrial cancer (hsa05213)
  Glioma (hsa05214)
  Prostate cancer (hsa05215)
  Thyroid cancer (hsa05216)
  Melanoma (hsa05218)
  Bladder cancer (hsa05219)
  Chronic myeloid leukemia (hsa05220)
  Acute myeloid leukemia (hsa05221)
  Non-small cell lung cancer (hsa05223)
  Breast cancer (hsa05224)
  Hepatocellular carcinoma (hsa05225)
  Gastric cancer (hsa05226)
  Central carbon metabolism in cancer (hsa05230)
  Choline metabolism in cancer (hsa05231)
  PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235)
  Lipid and atherosclerosis (hsa05417)
• Reactome Pathway:
  RAF-independent MAPK1/3 activation (R-HSA-112409)
  ISG15 antiviral mechanism (R-HSA-1169408)
  Signaling by NODAL (R-HSA-1181150)
  Spry regulation of FGF signaling (R-HSA-1295596)
  Signaling by Activin (R-HSA-1502540)
  Frs2-mediated activation (R-HSA-170968)
  ERK/MAPK targets (R-HSA-198753)
  ERKs are inactivated (R-HSA-202670)
  Regulation of actin dynamics for phagocytic cup formation (R-HSA-2029482)
  Downregulation of SMAD2/3 (R-HSA-2173795)
  SMAD2/SMAD3 (R-HSA-2173796)
  Oxidative Stress Induced Senescence (R-HSA-2559580)
  Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582)
  Oncogene Induced Senescence (R-HSA-2559585)
  FCERI mediated MAPK activation (R-HSA-2871796)
  Regulation of HSF1-mediated heat shock response (R-HSA-3371453)
  NCAM signaling for neurite out-growth (R-HSA-375165)
  RSK activation (R-HSA-444257)
  Signal transduction by L1 (R-HSA-445144)
  Activation of the AP-1 family of transcription factors (R-HSA-450341)
  Thrombin signalling through proteinase activated receptors (PARs) (R-HSA-456926)
  Negative regulation of FGFR1 signaling (R-HSA-5654726)
  Negative regulation of FGFR2 signaling (R-HSA-5654727)
  Negative regulation of FGFR3 signaling (R-HSA-5654732)
  Negative regulation of FGFR4 signaling (R-HSA-5654733)
  RHO GTPases Activate WASPs and WAVEs (R-HSA-5663213)
  RHO GTPases Activate NADPH Oxidases (R-HSA-5668599)
  RAF/MAP kinase cascade (R-HSA-5673001)
  MAP2K and MAPK activation (R-HSA-5674135)
  Negative feedback regulation of MAPK pathway (R-HSA-5674499)
  Negative regulation of MAPK pathway (R-HSA-5675221)
  Signaling by moderate kinase activity BRAF mutants (R-HSA-6802946)
  Signaling by high-kinase activity BRAF mutants (R-HSA-6802948)
  Signaling by BRAF and RAF1 fusions (R-HSA-6802952)
  Paradoxical activation of RAF signaling by kinase inactive BRAF (R-HSA-6802955)
  PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558)
  RNA Polymerase I Promoter Opening (R-HSA-73728)
  Signal attenuation (R-HSA-74749)
  Interferon gamma signaling (R-HSA-877300)
  Advanced glycosylation endproduct receptor signaling (R-HSA-879415)
  Gastrin-CREB signalling pathway via PKC and MAPK (R-HSA-881907)
  ESR-mediated signaling (R-HSA-8939211)
  RUNX2 regulates osteoblast differentiation (R-HSA-8940973)
  Regulation of PTEN gene transcription (R-HSA-8943724)
  Regulation of the apoptosome activity (R-HSA-9627069)
  Estrogen-dependent nuclear events downstream of ESR-membrane signaling (R-HSA-9634638)
  Suppression of apoptosis (R-HSA-9635465)
  Signaling downstream of RAS mutants (R-HSA-9649948)
  Signaling by MAP2K mutants (R-HSA-9652169)
  Signaling by RAF1 mutants (R-HSA-9656223)
  FCGR3A-mediated phagocytosis (R-HSA-9664422)
  Nuclear events stimulated by ALK signaling in cancer (R-HSA-9725371)
  IFNG signaling activates MAPKs (R-HSA-9732724)
  NPAS4 regulates expression of target genes (R-HSA-9768919)
  Growth hormone receptor signaling (R-HSA-982772)
  MAPK3 (ERK1) activation (R-HSA-110056)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Dacarbazine	DMNPZL4	Approved	Mitogen-activated protein kinase 3 (MAPK3) decreases the response to substance of Dacarbazine.	[97]
Thymoquinone	DMVDTR2	Phase 2/3	Mitogen-activated protein kinase 3 (MAPK3) decreases the response to substance of Thymoquinone.	[98]
PF-04691502	DMS610L	Phase 2	Mitogen-activated protein kinase 3 (MAPK3) affects the response to substance of PF-04691502.	[99]

70 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Mitogen-activated protein kinase 3 (MAPK3).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[6]
Arsenic	DMTL2Y1	Approved	Arsenic increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[8]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[12]
Decitabine	DMQL8XJ	Approved	Decitabine increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[16]
Marinol	DM70IK5	Approved	Marinol decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[17]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[18]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[19]
Progesterone	DMUY35B	Approved	Progesterone decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[20]
Menadione	DMSJDTY	Approved	Menadione increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[21]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[22]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[23]
Folic acid	DMEMBJC	Approved	Folic acid increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[25]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[26]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[27]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[29]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[30]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[31]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[32]
Etoposide	DMNH3PG	Approved	Etoposide increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[35]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[6]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[36]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[38]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[39]
Indomethacin	DMSC4A7	Approved	Indomethacin decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[40]
Mitomycin	DMH0ZJE	Approved	Mitomycin increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[41]
Permethrin	DMZ0Q1G	Approved	Permethrin increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[42]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[45]
Sulindac	DM2QHZU	Approved	Sulindac increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[46]
Methamphetamine	DMPM4SK	Approved	Methamphetamine affects the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[48]
Daunorubicin	DMQUSBT	Approved	Daunorubicin decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[49]
Pioglitazone	DMKJ485	Approved	Pioglitazone decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[50]
Acocantherin	DM7JT24	Approved	Acocantherin decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[51]
Thalidomide	DM70BU5	Approved	Thalidomide increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[52]
Phenytoin	DMNOKBV	Approved	Phenytoin decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[54]
Ursodeoxycholic acid	DMCUT21	Approved	Ursodeoxycholic acid increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[56]
Fluoxetine	DM3PD2C	Approved	Fluoxetine decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[58]
Sodium phenylbutyrate	DMXLBCQ	Approved	Sodium phenylbutyrate decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[59]
Beta-carotene	DM0RXBT	Approved	Beta-carotene increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[60]
Imatinib	DM7RJXL	Approved	Imatinib decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[61]
Sertraline	DM0FB1J	Approved	Sertraline increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[62]
Estrone	DM5T6US	Approved	Estrone increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[63]
Docetaxel	DMDI269	Approved	Docetaxel increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[65]
Isoproterenol	DMK7MEY	Approved	Isoproterenol increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[66]
Propofol	DMB4OLE	Approved	Propofol decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[69]
Glucosamine	DM4ZLFD	Approved	Glucosamine increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[70]
Isoniazid	DM5JVS3	Approved	Isoniazid decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[71]
Sevoflurane	DMC9O43	Approved	Sevoflurane increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[69]
Adenosine	DMM2NSK	Approved	Adenosine decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[72]
Morphine	DMRMS0L	Approved	Morphine increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[73]
Eicosapentaenoic acid/docosa-hexaenoic acid	DMMUCG4	Approved	Eicosapentaenoic acid/docosa-hexaenoic acid increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[74]
Dihydroxyacetone	DMM1LG2	Approved	Dihydroxyacetone increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[75]
Crizotinib	DM4F29C	Approved	Crizotinib decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[76]
Ciprofloxacin XR	DM2NLS9	Approved	Ciprofloxacin XR increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[77]
Cantharidin	DMBP5N3	Approved	Cantharidin increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[78]
Tetracycline	DMZA017	Approved	Tetracycline decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[79]
Methimazole	DM25FL8	Approved	Methimazole decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[80]
Mebendazole	DMO14SG	Approved	Mebendazole increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[81]
Romidepsin	DMT5GNL	Approved	Romidepsin decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[82]
Trovafloxacin	DM6AN32	Approved	Trovafloxacin increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[84]
Ergotidine	DM78IME	Approved	Ergotidine increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[85]
Masoprocol	DMMVNZ0	Approved	Masoprocol decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[89]
Carvedilol	DMHTEAO	Approved	Carvedilol increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[66]
Allopurinol	DMLPAOB	Approved	Allopurinol increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[90]
Epirubicin	DMPDW6T	Approved	Epirubicin increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[91]
Sanguinarine	DMDINFS	Approved	Sanguinarine increases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[93]
Omacetaxine mepesuccinate	DMPU2WX	Approved	Omacetaxine mepesuccinate decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[94]
Amsacrine	DMZKYIV	Approved	Amsacrine decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[95]
Fludarabine	DMVRLT7	Approved	Fludarabine decreases the phosphorylation of Mitogen-activated protein kinase 3 (MAPK3).	[96]

30 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[5]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[7]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[9]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[11]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the activity of Mitogen-activated protein kinase 3 (MAPK3).	[13]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[14]
Testosterone	DM7HUNW	Approved	Testosterone increases the activity of Mitogen-activated protein kinase 3 (MAPK3).	[15]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the activity of Mitogen-activated protein kinase 3 (MAPK3).	[24]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the activity of Mitogen-activated protein kinase 3 (MAPK3).	[28]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[33]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[34]
Nicotine	DMWX5CO	Approved	Nicotine decreases the activity of Mitogen-activated protein kinase 3 (MAPK3).	[37]
Cocaine	DMSOX7I	Approved	Cocaine increases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[43]
Simvastatin	DM30SGU	Approved	Simvastatin decreases the activity of Mitogen-activated protein kinase 3 (MAPK3).	[44]
Capsaicin	DMGMF6V	Approved	Capsaicin decreases the activity of Mitogen-activated protein kinase 3 (MAPK3).	[47]
Lindane	DMB8CNL	Approved	Lindane decreases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[53]
Sorafenib	DMS8IFC	Approved	Sorafenib decreases the activity of Mitogen-activated protein kinase 3 (MAPK3).	[55]
Gefitinib	DM15F0X	Approved	Gefitinib decreases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[57]
Dinoprostone	DMTYOPD	Approved	Dinoprostone increases the activity of Mitogen-activated protein kinase 3 (MAPK3).	[64]
Lovastatin	DM9OZWQ	Approved	Lovastatin decreases the activity of Mitogen-activated protein kinase 3 (MAPK3).	[44]
Ardeparin	DMYRX8B	Approved	Ardeparin increases the activity of Mitogen-activated protein kinase 3 (MAPK3).	[67]
Adenosine triphosphate	DM79F6G	Approved	Adenosine triphosphate increases the activity of Mitogen-activated protein kinase 3 (MAPK3).	[68]
Lapatinib	DM3BH1Y	Approved	Lapatinib decreases the activity of Mitogen-activated protein kinase 3 (MAPK3).	[83]
Clofibrate	DMPC1J7	Approved	Clofibrate decreases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[86]
Gamolenic acid	DMQN30Z	Approved	Gamolenic acid decreases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[87]
Busulfan	DMXYJ9C	Approved	Busulfan increases the activity of Mitogen-activated protein kinase 3 (MAPK3).	[88]
Ethacrynic acid	DM60QMR	Approved	Ethacrynic acid increases the expression of Mitogen-activated protein kinase 3 (MAPK3).	[92]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Caffeic acid attenuated acetaminophen-induced hepatotoxicity by inhibiting ERK1/2-mediated early growth response-1 transcriptional activation. Chem Biol Interact. 2016 Dec 25;260:186-195. doi: 10.1016/j.cbi.2016.10.009. Epub 2016 Oct 6.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Treatment with anticancer agents induces dysregulation of specific Wnt signaling pathways in human ovarian luteinized granulosa cells in vitro. Toxicol Sci. 2013 Nov;136(1):183-92. doi: 10.1093/toxsci/kft175. Epub 2013 Aug 16.
• [7] Estrogen Regulates MAPK-Related Genes through Genomic and Nongenomic Interactions between IGF-I Receptor Tyrosine Kinase and Estrogen Receptor-Alpha Signaling Pathways in Human Uterine Leiomyoma Cells. J Signal Transduct. 2012;2012:204236. doi: 10.1155/2012/204236. Epub 2012 Oct 9.
• [8] Reactive oxygen species contribute to arsenic-induced EZH2 phosphorylation in human bronchial epithelial cells and lung cancer cells. Toxicol Appl Pharmacol. 2014 May 1;276(3):165-70. doi: 10.1016/j.taap.2014.02.005. Epub 2014 Feb 25.
• [9] Quercetin and Cisplatin combined treatment altered cell cycle and mitogen activated protein kinase expressions in malignant mesotelioma cells. BMC Complement Altern Med. 2016 Aug 11;16(1):281. doi: 10.1186/s12906-016-1267-x.
• [10] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [11] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [12] SIRT3 Mediates the Antioxidant Effect of Hydrogen Sulfide in Endothelial Cells. Antioxid Redox Signal. 2016 Feb 20;24(6):329-43. doi: 10.1089/ars.2015.6331. Epub 2015 Nov 10.
• [13] Vitamin D3 induces autophagy in human monocytes/macrophages via cathelicidin. Cell Host Microbe. 2009 Sep 17;6(3):231-43. doi: 10.1016/j.chom.2009.08.004.
• [14] The proteasome inhibitor bortezomib interacts synergistically with histone deacetylase inhibitors to induce apoptosis in Bcr/Abl+ cells sensitive and resistant to STI571. Blood. 2003 Nov 15;102(10):3765-74. doi: 10.1182/blood-2003-03-0737. Epub 2003 Jul 31.
• [15] Dominant roles of the Raf/MEK/ERK pathway in cell cycle progression, prevention of apoptosis and sensitivity to chemotherapeutic drugs. Cell Cycle. 2010 Apr 15;9(8):1629-38. doi: 10.4161/cc.9.8.11487. Epub 2010 Apr 15.
• [16] Down-regulation of Rap1GAP via promoter hypermethylation promotes melanoma cell proliferation, survival, and migration. Cancer Res. 2009 Jan 15;69(2):449-57. doi: 10.1158/0008-5472.CAN-08-2399.
• [17] Cannabis-induced cytotoxicity in leukemic cell lines: the role of the cannabinoid receptors and the MAPK pathway. Blood. 2005 Feb 1;105(3):1214-21. doi: 10.1182/blood-2004-03-1182. Epub 2004 Sep 28.
• [18] Zoledronic acid induces antiproliferative and apoptotic effects in human pancreatic cancer cells in vitro. Br J Cancer. 2003 Jun 16;88(12):1971-8. doi: 10.1038/sj.bjc.6600986.
• [19] Non-dioxin-like-PCBs phosphorylate Mdm2 at Ser166 and attenuate the p53 response in HepG2 cells. Chem Biol Interact. 2009 Dec 10;182(2-3):191-8. doi: 10.1016/j.cbi.2009.09.004. Epub 2009 Sep 12.
• [20] Progesterone increases csk homologous kinase in HMC-1560 human mast cells and reduces cell proliferation. J Cell Biochem. 2007 Dec 1;102(5):1271-80. doi: 10.1002/jcb.21357.
• [21] DLPC and SAMe prevent alpha1(I) collagen mRNA up-regulation in human hepatic stellate cells, whether caused by leptin or menadione. Biochem Biophys Res Commun. 2006 Nov 10;350(1):50-5. doi: 10.1016/j.bbrc.2006.08.174. Epub 2006 Sep 18.
• [22] Nicotine increases survival in human colon cancer cells treated with chemotherapeutic drugs. Toxicol In Vitro. 2013 Dec;27(8):2256-63. doi: 10.1016/j.tiv.2013.09.020. Epub 2013 Oct 2.
• [23] Estrogen and pure antiestrogen fulvestrant (ICI 182 780) augment cell-matrigel adhesion of MCF-7 breast cancer cells through a novel G protein coupled estrogen receptor (GPR30)-to-calpain signaling axis. Toxicol Appl Pharmacol. 2014 Mar 1;275(2):176-81. doi: 10.1016/j.taap.2014.01.005. Epub 2014 Jan 17.
• [24] Dexamethasone suppresses DU145 cell proliferation and cell cycle through inhibition of the extracellular signal-regulated kinase 1/2 pathway and cyclin D1 expression. Asian J Androl. 2008 Jul;10(4):635-41. doi: 10.1111/j.1745-7262.2008.00352.x. Epub 2007 Dec 20.
• [25] Folic acid mediates activation of the pro-oncogene STAT3 via the Folate Receptor alpha. Cell Signal. 2015 Jul;27(7):1356-68. doi: 10.1016/j.cellsig.2015.03.020. Epub 2015 Apr 2.
• [26] Niclosamide, an anti-helminthic molecule, downregulates the retroviral oncoprotein Tax and pro-survival Bcl-2 proteins in HTLV-1-transformed T lymphocytes. Biochem Biophys Res Commun. 2015 Aug 14;464(1):221-228. doi: 10.1016/j.bbrc.2015.06.120. Epub 2015 Jun 23.
• [27] Cannabidiol upregulates melanogenesis through CB1 dependent pathway by activating p38 MAPK and p42/44 MAPK. Chem Biol Interact. 2017 Aug 1;273:107-114. doi: 10.1016/j.cbi.2017.06.005. Epub 2017 Jun 7.
• [28] Mitochondrial Bax translocation partially mediates synergistic cytotoxicity between histone deacetylase inhibitors and proteasome inhibitors in glioma cells. Neuro Oncol. 2008 Jun;10(3):309-19. doi: 10.1215/15228517-2007-063. Epub 2008 Apr 29.
• [29] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [30] p38 MAPK/PP2Ac/TTP pathway on the connection of TNF- and caspases activation on hydroquinone-induced apoptosis. Carcinogenesis. 2013 Apr;34(4):818-27. doi: 10.1093/carcin/bgs409. Epub 2013 Jan 3.
• [31] Rosiglitazone inhibits alpha4 nicotinic acetylcholine receptor expression in human lung carcinoma cells through peroxisome proliferator-activated receptor gamma-independent signals. Mol Cancer Ther. 2009 Jan;8(1):110-8. doi: 10.1158/1535-7163.MCT-08-0719.
• [32] Azathioprine desensitizes liver cancer cells to insulin-like growth factor 1 and causes apoptosis when it is combined with bafilomycin A1. Toxicol Appl Pharmacol. 2013 Nov 1;272(3):568-78. doi: 10.1016/j.taap.2013.07.024. Epub 2013 Aug 16.
• [33] The use of genomics technology to investigate gene expression changes in cultured human liver cells. Toxicol In Vitro. 2001 Aug-Oct;15(4-5):399-405. doi: 10.1016/s0887-2333(01)00043-1.
• [34] [Aspirin inhibits proliferation and expression of p44/42 MAPK phosphorylation in vascular endothelial cells]. Di Yi Jun Yi Da Xue Xue Bao. 2004 Sep;24(9):1013-5.
• [35] Modulation of apoptosis in HaCaT keratinocytes via differential regulation of ERK signaling pathway by flavonoids. J Biol Chem. 2005 Sep 9;280(36):31498-507. doi: 10.1074/jbc.M505537200. Epub 2005 Jul 13.
• [36] Evaluation and mechanistic analysis of the cytotoxicity of the acyl glucuronide of nonsteroidal anti-inflammatory drugs. Drug Metab Dispos. 2014 Jan;42(1):1-8. doi: 10.1124/dmd.113.054478. Epub 2013 Oct 8.
• [37] Long-term nicotine exposure-induced chemoresistance is mediated by activation of Stat3 and downregulation of ERK1/2 via nAChR and beta-adrenoceptors in human bladder cancer cells. Toxicol Sci. 2010 May;115(1):118-30. doi: 10.1093/toxsci/kfq028. Epub 2010 Jan 27.
• [38] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [39] The kinase inhibitor dasatinib induces apoptosis in chronic lymphocytic leukemia cells in vitro with preference for a subgroup of patients with unmutated IgVH genes. Blood. 2008 Aug 15;112(4):1443-52. doi: 10.1182/blood-2007-11-123984. Epub 2008 Jun 12.
• [40] Indomethacin-enhanced anticancer effect of arsenic trioxide in A549 cell line: involvement of apoptosis and phospho-ERK and p38 MAPK pathways. Biomed Res Int. 2013;2013:237543.
• [41] Curcumin enhances the mitomycin C-induced cytotoxicity via downregulation of MKK1/2-ERK1/2-mediated Rad51 expression in non-small cell lung cancer cells. Toxicol Appl Pharmacol. 2011 Sep 15;255(3):327-38. doi: 10.1016/j.taap.2011.07.012. Epub 2011 Jul 24.
• [42] Permethrin, a pyrethroid insecticide, regulates ERK1/2 activation through membrane depolarization-mediated pathway in HepG2 hepatocytes. Food Chem Toxicol. 2018 Nov;121:387-395. doi: 10.1016/j.fct.2018.09.009. Epub 2018 Sep 8.
• [43] Transcriptional profiling in the human prefrontal cortex: evidence for two activational states associated with cocaine abuse. Pharmacogenomics J. 2003;3(1):27-40.
• [44] Simvastatin and lovastatin inhibit breast cell invasion induced by H-Ras. Oncol Rep. 2009 May;21(5):1317-22. doi: 10.3892/or_00000357.
• [45] Extracellular signal-regulated kinase activation and Bcl-2 downregulation mediate apoptosis after gemcitabine treatment partly via a p53-independent pathway. Eur J Pharmacol. 2004 Oct 19;502(3):169-83. doi: 10.1016/j.ejphar.2004.09.006.
• [46] Combination treatment with arsenic trioxide and sulindac enhances apoptotic cell death in lung cancer cells via activation of oxidative stress and mitogen-activated protein kinases. Oncol Rep. 2008 Aug;20(2):379-84.
• [47] Roles of JNK-1 and p38 in selective induction of apoptosis by capsaicin in ras-transformed human breast epithelial cells. Int J Cancer. 2003 Feb 10;103(4):475-82. doi: 10.1002/ijc.10855.
• [48] Methamphetamine exposure upregulates the amyloid precursor protein and hyperphosphorylated tau expression: The roles of insulin signaling in SH-SY5Y cell line. J Toxicol Sci. 2019;44(7):493-503. doi: 10.2131/jts.44.493.
• [49] CREB/Sp1-mediated MCL1 expression and NFB-mediated ABCB1 expression modulate the cytotoxicity of daunorubicin in chronic myeloid leukemia cells. Toxicol Appl Pharmacol. 2022 Jan 15;435:115847. doi: 10.1016/j.taap.2021.115847. Epub 2021 Dec 25.
• [50] Pioglitazone, a PPAR agonist, attenuates PDGF-induced vascular smooth muscle cell proliferation through AMPK-dependent and AMPK-independent inhibition of mTOR/p70S6K and ERK signaling. Biochem Pharmacol. 2016 Feb 1;101:54-70. doi: 10.1016/j.bcp.2015.11.026. Epub 2015 Nov 28.
• [51] Ouabain impairs cell migration, and invasion and alters gene expression of human osteosarcoma U-2 OS cells. Environ Toxicol. 2017 Nov;32(11):2400-2413. doi: 10.1002/tox.22453. Epub 2017 Aug 10.
• [52] Antimyeloma activity of two novel N-substituted and tetraflourinated thalidomide analogs. Leukemia. 2005 Jul;19(7):1253-61. doi: 10.1038/sj.leu.2403776.
• [53] Long-term exposure to beta-hexachlorocyclohexane (beta-HCH) promotes transformation and invasiveness of MCF-7 human breast cancer cells. Biochem Pharmacol. 2003 Sep 1;66(5):831-40. doi: 10.1016/s0006-2952(03)00394-0.
• [54] Impaired degradation of matrix collagen in human gingival fibroblasts by the antiepileptic drug phenytoin. J Periodontol. 2005 Jun;76(6):941-50. doi: 10.1902/jop.2005.76.6.941.
• [55] Differential effects of arsenic trioxide on chemosensitization in human hepatic tumor and stellate cell lines. BMC Cancer. 2012 Sep 10;12:402.
• [56] Ursodeoxycholic acid but not tauroursodeoxycholic acid inhibits proliferation and differentiation of human subcutaneous adipocytes. PLoS One. 2013 Dec 3;8(12):e82086. doi: 10.1371/journal.pone.0082086. eCollection 2013.
• [57] Growth of hormone-dependent MCF-7 breast cancer cells is promoted by constitutive caveolin-1 whose expression is lost in an EGF-R-mediated manner during development of tamoxifen resistance. Breast Cancer Res Treat. 2010 Feb;119(3):575-91. doi: 10.1007/s10549-009-0355-8. Epub 2009 Mar 15.
• [58] Fluoxetine inhibits the extracellular signal regulated kinase pathway and suppresses growth of cancer cells. Cancer Biol Ther. 2008 Oct;7(10):1685-93. doi: 10.4161/cbt.7.10.6664. Epub 2008 Oct 22.
• [59] Selenite induced breast cancer MCF7 cells apoptosis through endoplasmic reticulum stress and oxidative stress pathway. Chem Biol Interact. 2021 Nov 1;349:109651. doi: 10.1016/j.cbi.2021.109651. Epub 2021 Sep 11.
• [60] Growth stimulation of human pulmonary adenocarcinoma cells and small airway epithelial cells by beta-carotene via activation of cAMP, PKA, CREB and ERK1/2. Int J Cancer. 2006 Mar 15;118(6):1370-80. doi: 10.1002/ijc.21537.
• [61] Imatinib mesylate inhibits T-cell proliferation in vitro and delayed-type hypersensitivity in vivo. Blood. 2004 Aug 15;104(4):1094-9. doi: 10.1182/blood-2003-12-4266. Epub 2004 Apr 20.
• [62] Sertraline, an antidepressant, induces apoptosis in hepatic cells through the mitogen-activated protein kinase pathway. Toxicol Sci. 2014 Feb;137(2):404-15. doi: 10.1093/toxsci/kft254. Epub 2013 Nov 5.
• [63] LC, a novel estrone-rhein hybrid compound, promotes proliferation and differentiation and protects against cell death in human osteoblastic MG-63 cells. Mol Cell Endocrinol. 2011 Sep 15;344(1-2):59-68. doi: 10.1016/j.mce.2011.06.027. Epub 2011 Jul 13.
• [64] Celecoxib induces hepatic stellate cell apoptosis through inhibition of Akt activation and suppresses hepatic fibrosis in rats. Gut. 2009 Nov;58(11):1517-27. doi: 10.1136/gut.2008.157420. Epub 2009 Feb 6.
• [65] Docetaxel induces p53-dependent apoptosis and synergizes with farnesyl transferase inhibitor r115777 in human epithelial cancer cells. Front Biosci. 2005 Sep 1;10:2566-75. doi: 10.2741/1720.
• [66] A unique mechanism of beta-blocker action: carvedilol stimulates beta-arrestin signaling. Proc Natl Acad Sci U S A. 2007 Oct 16;104(42):16657-62. doi: 10.1073/pnas.0707936104. Epub 2007 Oct 9.
• [67] Heparin prevents programmed cell death in human trophoblast. Mol Hum Reprod. 2006 Apr;12(4):237-43. doi: 10.1093/molehr/gal026. Epub 2006 Mar 23.
• [68] Interactive effects of in vitro binge-like alcohol and ATP on umbilical endothelial nitric oxide synthase post-translational modifications and redox modulation. Reprod Toxicol. 2014 Jan;43:94-101.
• [69] Sevoflurane but not propofol enhances ovarian cancer cell biology through regulating cellular metabolic and signaling mechanisms. Cell Biol Toxicol. 2023 Aug;39(4):1395-1411. doi: 10.1007/s10565-022-09766-6. Epub 2022 Oct 8.
• [70] Disease-modifying effects of glucosamine HCl involving regulation of metalloproteinases and chemokines activated by interleukin-1beta in human primary synovial fibroblasts. J Cell Biochem. 2008 May 1;104(1):38-50. doi: 10.1002/jcb.21597.
• [71] Quercetin protected against isoniazide-induced HepG2 cell apoptosis by activating the SIRT1/ERK pathway. J Biochem Mol Toxicol. 2019 Sep;33(9):e22369. doi: 10.1002/jbt.22369. Epub 2019 Jul 23.
• [72] Adenosine downregulates DPPIV on HT-29 colon cancer cells by stimulating protein tyrosine phosphatase(s) and reducing ERK1/2 activity via a novel pathway. Am J Physiol Cell Physiol. 2006 Sep;291(3):C433-44.
• [73] opioid receptor agonist-selective regulation of interleukin-4 in T lymphocytes. J Neuroimmunol. 2013 Oct 15;263(1-2):35-42. doi: 10.1016/j.jneuroim.2013.07.012. Epub 2013 Jul 25.
• [74] Insight into the molecular mechanism of heme oxygenase-1 induction by docosahexaenoic acid in U937 cells. Chem Biol Interact. 2015 Aug 5;238:180-8. doi: 10.1016/j.cbi.2015.07.005. Epub 2015 Jul 7.
• [75] The sunless tanning agent dihydroxyacetone induces stress response gene expression and signaling in cultured human keratinocytes and reconstructed epidermis. Redox Biol. 2020 Sep;36:101594. doi: 10.1016/j.redox.2020.101594. Epub 2020 May 29.
• [76] Therapeutic strategies to overcome crizotinib resistance in non-small cell lung cancers harboring the fusion oncogene EML4-ALK. Proc Natl Acad Sci U S A. 2011 May 3;108(18):7535-40. doi: 10.1073/pnas.1019559108. Epub 2011 Apr 18.
• [77] Ciprofloxacin mediates cancer stem cell phenotypes in lung cancer cells through caveolin-1-dependent mechanism. Chem Biol Interact. 2016 Apr 25;250:1-11.
• [78] Anticancer effects of cantharidin in A431 human skin cancer (Epidermoid carcinoma) cells in vitro and in vivo. Environ Toxicol. 2017 Mar;32(3):723-738. doi: 10.1002/tox.22273. Epub 2016 Apr 25.
• [79] Increased hepatic Fatty Acid uptake and esterification contribute to tetracycline-induced steatosis in mice. Toxicol Sci. 2015 Jun;145(2):273-82. doi: 10.1093/toxsci/kfv049. Epub 2015 Mar 4.
• [80] Low-expressional IGF1 mediated methimazole-induced liver developmental toxicity in fetal mice. Toxicology. 2018 Sep 1;408:70-79. doi: 10.1016/j.tox.2018.07.004. Epub 2018 Jul 7.
• [81] Stimulation of pro-inflammatory responses by mebendazole in human monocytic THP-1 cells through an ERK signaling pathway. Arch Toxicol. 2011 Mar;85(3):199-207. doi: 10.1007/s00204-010-0584-y. Epub 2010 Sep 17.
• [82] Inhibitors of class I HDACs and of FLT3 combine synergistically against leukemia cells with mutant FLT3. Arch Toxicol. 2022 Jan;96(1):177-193. doi: 10.1007/s00204-021-03174-1. Epub 2021 Oct 19.
• [83] CDK4/6 inhibition provides a potent adjunct to Her2-targeted therapies in preclinical breast cancer models. Genes Cancer. 2014 Jul;5(7-8):261-72. doi: 10.18632/genesandcancer.24.
• [84] TNF enhances trovafloxacin-induced in vitro hepatotoxicity by inhibiting protective autophagy. Toxicol Lett. 2021 May 15;342:73-84. doi: 10.1016/j.toxlet.2021.02.009. Epub 2021 Feb 17.
• [85] Histamine stimulation of MMP-1(collagenase-1) secretion and gene expression in gastric epithelial cells: role of EGFR transactivation and the MAP kinase pathway. Int J Biochem Cell Biol. 2007;39(11):2143-52. doi: 10.1016/j.biocel.2007.06.003. Epub 2007 Jun 24.
• [86] Steroid receptor coactivator 1 deficiency increases MMTV-neu mediated tumor latency and differentiation specific gene expression, decreases metastasis, and inhibits response to PPAR ligands. BMC Cancer. 2010 Nov 16;10:629. doi: 10.1186/1471-2407-10-629.
• [87] A retinoid X receptor (RXR)-selective retinoid reveals that RXR-alpha is potentially a therapeutic target in breast cancer cell lines, and that it potentiates antiproliferative and apoptotic responses to peroxisome proliferator-activated receptor ligands. Breast Cancer Res. 2004;6(5):R546-55. doi: 10.1186/bcr913. Epub 2004 Jul 23.
• [88] Busulfan selectively induces cellular senescence but not apoptosis in WI38 fibroblasts via a p53-independent but extracellular signal-regulated kinase-p38 mitogen-activated protein kinase-dependent mechanism. J Pharmacol Exp Ther. 2006 Nov;319(2):551-60. doi: 10.1124/jpet.106.107771. Epub 2006 Aug 1.
• [89] Reactive oxygen species and lipoxygenases regulate the oncogenicity of NPM-ALK-positive anaplastic large cell lymphomas. Oncogene. 2009 Jul 23;28(29):2690-6.
• [90] Allopurinol induces innate immune responses through mitogen-activated protein kinase signaling pathways in HL-60 cells. J Appl Toxicol. 2016 Sep;36(9):1120-8. doi: 10.1002/jat.3272. Epub 2015 Dec 7.
• [91] (-)-Gossypol enhances the anticancer activity of epirubicin via downregulating survivin in hepatocellular carcinoma. Chem Biol Interact. 2022 Sep 1;364:110060. doi: 10.1016/j.cbi.2022.110060. Epub 2022 Jul 22.
• [92] Characterization of cell death induced by ethacrynic acid in a human colon cancer cell line DLD-1 and suppression by N-acetyl-L-cysteine. Cancer Sci. 2003 Oct;94(10):886-93.
• [93] Sanguinarine induces apoptosis in A549 human lung cancer cells primarily via cellular glutathione depletion. Toxicol In Vitro. 2009 Mar;23(2):281-7. doi: 10.1016/j.tiv.2008.12.013. Epub 2008 Dec 24.
• [94] Homoharringtonine suppresses LoVo cell growth by inhibiting EphB4 and the PI3K/AKT and MAPK/EKR1/2 signaling pathways. Food Chem Toxicol. 2020 Feb;136:110960. doi: 10.1016/j.fct.2019.110960. Epub 2019 Nov 11.
• [95] Amsacrine downregulates BCL2L1 expression and triggers apoptosis in human chronic myeloid leukemia cells through the SIDT2/NOX4/ERK/HuR pathway. Toxicol Appl Pharmacol. 2023 Sep 1;474:116625. doi: 10.1016/j.taap.2023.116625. Epub 2023 Jul 13.
• [96] 9-beta-D-arabinofuranosyl-2-fluoroadenine inhibits expression of vascular endothelial growth factor through hypoxia-inducible factor-1 in human ovarian cancer cells. Mol Pharmacol. 2004 Jul;66(1):178-86. doi: 10.1124/mol.66.1.178.
• [97] Exposure of melanoma cells to dacarbazine results in enhanced tumor growth and metastasis in vivo. J Clin Oncol. 2004 Jun 1;22(11):2092-100. doi: 10.1200/JCO.2004.11.070. Epub 2004 May 3.
• [98] Erk phosphorylation reduces the thymoquinone toxicity in human hepatocarcinoma. Environ Toxicol. 2021 Oct;36(10):1990-1998. doi: 10.1002/tox.23317. Epub 2021 Jun 26.
• [99] Synergistic inhibition of ovarian cancer cell growth by combining selective PI3K/mTOR and RAS/ERK pathway inhibitors. Eur J Cancer. 2013 Dec;49(18):3936-44. doi: 10.1016/j.ejca.2013.08.007. Epub 2013 Sep 3.