Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGEXULW)

• DOT Name: Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2)
• Synonyms: Development and differentiation-enhancing factor 2; Paxillin-associated protein with ARF GAP activity 3; PAG3; Pyk2 C-terminus-associated protein; PAP
• Gene Name: ASAP2
• Related Disease:
  Bacteremia
  Multiple sclerosis
  Obstructive sleep apnea
  Parkinson disease
  Adult glioblastoma
  Androgen insensitivity syndrome
  Arrhythmia
  Atrial fibrillation
  Autosomal dominant optic atrophy, classic form
  Cervical cancer
  Cervical carcinoma
  Classic Hodgkin lymphoma
  Colitis
  Glioblastoma multiforme
  Hepatitis B virus infection
  Huntington disease
  leukaemia
  Leukemia
  Male infertility
  Neoplasm
  Obesity
  Pancreatic cancer
  Post-traumatic stress disorder
  Precancerous condition
  Scleroderma
  Severe combined immunodeficiency
  Sleep apnea syndrome
  Systemic lupus erythematosus
  Systemic sclerosis
  Type-1/2 diabetes
  Cervical Intraepithelial neoplasia
  Cholangiocarcinoma
  Methicillin-resistant staphylococci infection
  Prostate neoplasm
  Pulmonary emphysema
  Amyotrophic lateral sclerosis
  Ankylosing spondylitis
  Bipolar disorder
  Chronic obstructive pulmonary disease
  Colorectal carcinoma
  Crohn disease
  Human papillomavirus infection
  Pancreatitis
  Pituitary tumor
  Psoriasis
  Psychotic disorder
  Sclerosing cholangitis
  Ulcerative colitis
• UniProt ID: ASAP2_HUMAN
• Pfam ID: PF12796 ; PF01412 ; PF16746 ; PF00169 ; PF14604
• Sequence:
  MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKA
  INSSGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMN
  NIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISG
  AEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVES
  LKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDSQIRQSTAYSLHQPQG
  NKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVKTNP
  EEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELT
  KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDV
  LGTSELLLAKNIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKH
  ADNAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTS
  LHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDI
  AKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDMDEKLQPSPNRREDRP
  ISFYQLGSNQLQSNAVSLARDAANLAKEKQRAFMPSILQNETYGALLSGSPPPAQPAAPS
  TTSAPPLPPRNVGKVQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN
  PLTPTPPPPVAKTPSVMEALSQPSKPAPPGISQIRPPPLPPQPPSRLPQKKPAPGADKST
  PLTNKGQPRGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNP
  DELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD
• Function: Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration.
• Tissue Specificity: Detected in heart, brain, placenta, kidney, monocytes and pancreas.
• KEGG Pathway:
  Endocytosis (hsa04144)
  Fc gamma R-mediated phagocytosis (hsa04666)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bacteremia	DIS6N9RZ	Definitive	Biomarker	[1]
Multiple sclerosis	DISB2WZI	Definitive	Genetic Variation	[2]
Obstructive sleep apnea	DIS0SVD1	Definitive	Biomarker	[3]
Parkinson disease	DISQVHKL	Definitive	Biomarker	[4]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[5]
Androgen insensitivity syndrome	DISUZBBO	Strong	Biomarker	[6]
Arrhythmia	DISFF2NI	Strong	Biomarker	[7]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[7]
Autosomal dominant optic atrophy, classic form	DISXUAV9	Strong	Biomarker	[8]
Cervical cancer	DISFSHPF	Strong	Biomarker	[9]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[9]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[10]
Colitis	DISAF7DD	Strong	Biomarker	[11]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[5]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[12]
Huntington disease	DISQPLA4	Strong	Biomarker	[10]
leukaemia	DISS7D1V	Strong	Altered Expression	[13]
Leukemia	DISNAKFL	Strong	Genetic Variation	[13]
Male infertility	DISY3YZZ	Strong	Altered Expression	[14]
Neoplasm	DISZKGEW	Strong	Biomarker	[15]
Obesity	DIS47Y1K	Strong	Biomarker	[16]
Pancreatic cancer	DISJC981	Strong	Biomarker	[17]
Post-traumatic stress disorder	DISHL1EY	Strong	Biomarker	[18]
Precancerous condition	DISV06FL	Strong	Biomarker	[19]
Scleroderma	DISVQ342	Strong	Biomarker	[20]
Severe combined immunodeficiency	DIS6MF4Q	Strong	Biomarker	[13]
Sleep apnea syndrome	DISER6KS	Strong	Biomarker	[21]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[22]
Systemic sclerosis	DISF44L6	Strong	Biomarker	[20]
Type-1/2 diabetes	DISIUHAP	Strong	Genetic Variation	[16]
Cervical Intraepithelial neoplasia	DISXP757	moderate	Genetic Variation	[23]
Cholangiocarcinoma	DIS71F6X	moderate	Genetic Variation	[24]
Methicillin-resistant staphylococci infection	DIS6DRDZ	moderate	Biomarker	[25]
Prostate neoplasm	DISHDKGQ	moderate	Altered Expression	[26]
Pulmonary emphysema	DIS5M7HZ	moderate	Biomarker	[24]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Biomarker	[27]
Ankylosing spondylitis	DISRC6IR	Limited	Genetic Variation	[28]
Bipolar disorder	DISAM7J2	Limited	Genetic Variation	[29]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Biomarker	[30]
Colorectal carcinoma	DIS5PYL0	Limited	Genetic Variation	[31]
Crohn disease	DIS2C5Q8	Limited	Genetic Variation	[28]
Human papillomavirus infection	DISX61LX	Limited	Genetic Variation	[32]
Pancreatitis	DIS0IJEF	Limited	Altered Expression	[17]
Pituitary tumor	DISN67JD	Limited	Biomarker	[33]
Psoriasis	DIS59VMN	Limited	Genetic Variation	[28]
Psychotic disorder	DIS4UQOT	Limited	Biomarker	[34]
Sclerosing cholangitis	DIS7GZNB	Limited	Genetic Variation	[28]
Ulcerative colitis	DIS8K27O	Limited	Genetic Variation	[28]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[35]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[40]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[48]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[36]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[37]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[38]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[39]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[36]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[41]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[42]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[43]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[26]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[45]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[46]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[49]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2).	[50]

References

• [1] In vivo-generated thrombin and plasmin do not activate the complement system in baboons.Blood. 2017 Dec 14;130(24):2678-2681. doi: 10.1182/blood-2017-06-788216. Epub 2017 Oct 11.
• [2] Replication of top markers of a genome-wide association study in multiple sclerosis in Spain.Genes Immun. 2011 Mar;12(2):110-5. doi: 10.1038/gene.2010.52. Epub 2010 Oct 14.
• [3] Polysomnographic determinants of requirement for advanced positive pressure therapeutic options for obstructive sleep apnea.Sleep Breath. 2018 May;22(2):401-409. doi: 10.1007/s11325-017-1556-8. Epub 2017 Aug 18.
• [4] Treating sleep apnea in Parkinson's disease with C-PAP: feasibility concerns and effects on cognition and alertness.Sleep Med. 2017 May;33:114-118. doi: 10.1016/j.sleep.2017.01.009. Epub 2017 Jan 27.
• [5] The HIF-2alpha dependent induction of PAP and adenosine synthesis regulates glioblastoma stem cell function through the A2B adenosine receptor.Int J Biochem Cell Biol. 2014 Apr;49:8-16. doi: 10.1016/j.biocel.2014.01.007. Epub 2014 Jan 13.
• [6] Human papillomavirus (HPV) test and PAP smear as predictors of outcome in conservatively treated adenocarcinoma in situ (AIS) of the uterine cervix.Gynecol Oncol. 2007 Jul;106(1):170-6. doi: 10.1016/j.ygyno.2007.03.016. Epub 2007 May 4.
• [7] Improvement in Sleep-Disordered Breathing Indices Downloaded From a Positive Airway Pressure Machine Following Conversion of Atrial Fibrillation to Sinus Rhythm.J Clin Sleep Med. 2018 Nov 15;14(11):1953-1957. doi: 10.5664/jcsm.7502.
• [8] Facilitating physical activity and reducing symptoms in patients with knee osteoarthritis: study protocol of a randomized controlled trial to test a theory-based PrevOP-psychological adherence program (PrevOP-PAP).BMC Musculoskelet Disord. 2018 Jul 18;19(1):221. doi: 10.1186/s12891-018-2158-8.
• [9] Early diagnosis behavior in Turkish women with and without a family history of cervical cancer.Asian Pac J Cancer Prev. 2015;16(2):401-6. doi: 10.7314/apjcp.2015.16.2.401.
• [10] Infrainguinal bypass surgery outcomes are worse in hemodialysis patients compared with patients with renal transplants.J Vasc Surg. 2019 Mar;69(3):850-856. doi: 10.1016/j.jvs.2018.05.252. Epub 2018 Dec 21.
• [11] Oral delivery of pancreatitis-associated protein by Lactococcus lactis displays protective effects in dinitro-benzenesulfonic-acid-induced colitis model and is able to modulate the composition of the microbiota.Environ Microbiol. 2019 Nov;21(11):4020-4031. doi: 10.1111/1462-2920.14748. Epub 2019 Sep 10.
• [12] Inhibition of hepatitis B virus replication by pokeweed antiviral protein in vitro.World J Gastroenterol. 2008 Mar 14;14(10):1592-7. doi: 10.3748/wjg.14.1592.
• [13] Effective immunochemotherapy of human t(4;11) leukemia in mice with severe combined immunodeficiency (SCID) using B43 (anti-CD19)-pokeweed antiviral protein immunotoxin plus cyclophosphamide.Leukemia. 1993 Feb;7(2):290-7.
• [14] MiR-125b-2 Knockout in Testis Is Associated with Targeting to the PAP Gene, Mitochondrial Copy Number, and Impaired Sperm Quality.Int J Mol Sci. 2019 Jan 3;20(1):148. doi: 10.3390/ijms20010148.
• [15] Detection of high-grade neoplasia in air-dried cervical PAP smears by a microRNA-based classifier.Oncol Rep. 2018 Mar;39(3):1099-1111. doi: 10.3892/or.2018.6214. Epub 2018 Jan 12.
• [16] Mutations in MKKS cause Bardet-Biedl syndrome.Nat Genet. 2000 Sep;26(1):15-6. doi: 10.1038/79116.
• [17] PAP/REG3A favors perineural invasion in pancreatic adenocarcinoma and serves as a prognostic marker.Cell Mol Life Sci. 2017 Nov;74(22):4231-4243. doi: 10.1007/s00018-017-2579-9. Epub 2017 Jun 27.
• [18] Treatment of OSA with CPAP Is Associated with Improvement in PTSD Symptoms among Veterans.J Clin Sleep Med. 2017 Jan 15;13(1):57-63. doi: 10.5664/jcsm.6388.
• [19] Detection of HPV and ras gene mutations in cervical smears from female genital lesions.Oncol Rep. 1998 Sep-Oct;5(5):1195-8. doi: 10.3892/or.5.5.1195.
• [20] Changes in pulmonary exercise haemodynamics in scleroderma: a 4-year prospective study.Eur Respir J. 2017 Jul 13;50(1):1601708. doi: 10.1183/13993003.01708-2016. Print 2017 Jul.
• [21] Economic Assessment of 4 Approaches to the Diagnosis and Initial Treatment of Sleep Apnea.Respir Care. 2018 Jan;63(1):50-61. doi: 10.4187/respcare.05355. Epub 2017 Oct 24.
• [22] Evaluation of pulmonary artery pressure in patients with juvenile systemic lupus erythematosus (jSLE).Bosn J Basic Med Sci. 2018 Feb 20;18(1):66-71. doi: 10.17305/bjbms.2017.2178.
• [23] Adherence to gynecological screening impacted by experienced orthodontic treatment in childhood.Arch Gynecol Obstet. 2019 Jan;299(1):167-171. doi: 10.1007/s00404-018-4950-y. Epub 2018 Oct 30.
• [24] Role for interleukin-6 in COPD-related pulmonary hypertension.Chest. 2009 Sep;136(3):678-687. doi: 10.1378/chest.08-2420. Epub 2009 Apr 6.
• [25] Screening for Intermediately Vancomycin-Susceptible and Vancomycin-Heteroresistant Staphylococcus aureus by Use of Vancomycin-Supplemented Brain Heart Infusion Agar Biplates: Defining Growth Interpretation Criteria Based on Gold Standard Confirmation.J Clin Microbiol. 2015 Nov;53(11):3543-6. doi: 10.1128/JCM.01620-15. Epub 2015 Aug 26.
• [26] Differentially expressed genes in the prostate cancer cell line LNCaP after exposure to androgen and anti-androgen. Cancer Genet Cytogenet. 2006 Apr 15;166(2):130-8. doi: 10.1016/j.cancergencyto.2005.09.012.
• [27] Associative Increases in Amyotrophic Lateral Sclerosis Survival Duration With Non-invasive Ventilation Initiation and Usage Protocols.Front Neurol. 2018 Jul 12;9:578. doi: 10.3389/fneur.2018.00578. eCollection 2018.
• [28] Analysis of five chronic inflammatory diseases identifies 27 new associations and highlights disease-specific patterns at shared loci.Nat Genet. 2016 May;48(5):510-8. doi: 10.1038/ng.3528. Epub 2016 Mar 14.
• [29] Genome-wide association study identifies 30 loci associated with bipolar disorder.Nat Genet. 2019 May;51(5):793-803. doi: 10.1038/s41588-019-0397-8. Epub 2019 May 1.
• [30] The evaluation of cardiac functions according to chronic obstructive pulmonary disease groups.Aging Male. 2020 Jun;23(2):106-111. doi: 10.1080/13685538.2019.1606191. Epub 2019 Apr 30.
• [31] Death from early colorectal cancer is predicted by the presence of transcripts of the REG gene family.Br J Cancer. 2000 Jul;83(2):188-95. doi: 10.1054/bjoc.2000.1227.
• [32] Prevalence of human papillomavirus infection in women in the Autonomous Region of Inner Mongolia: A population-based study of a Chinese ethnic minority.J Med Virol. 2018 Jan;90(1):148-156. doi: 10.1002/jmv.24888. Epub 2017 Oct 6.
• [33] Identification of differentially coexpressed genes in gonadotrope tumors and normal pituitary using bioinformatics methods.Pathol Oncol Res. 2014 Apr;20(2):375-80. doi: 10.1007/s12253-013-9706-1. Epub 2013 Nov 7.
• [34] Increased frequency of psychosis after second-generation antiepileptic drug administration in adults with focal epilepsy.Epilepsy Behav. 2019 Aug;97:138-143. doi: 10.1016/j.yebeh.2019.06.002. Epub 2019 Jun 25.
• [35] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [36] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [37] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [38] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [39] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [40] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [41] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [42] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [43] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [44] Differentially expressed genes in the prostate cancer cell line LNCaP after exposure to androgen and anti-androgen. Cancer Genet Cytogenet. 2006 Apr 15;166(2):130-8. doi: 10.1016/j.cancergencyto.2005.09.012.
• [45] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
• [46] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [47] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [48] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [49] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [50] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.