Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTILU5S7)

• DOT Name: Delta(14)-sterol reductase TM7SF2 (TM7SF2)
• Synonyms: Delta-14-SR; EC 1.3.1.70; 3-beta-hydroxysterol Delta (14)-reductase; Another new gene 1 protein; C-14 sterol reductase; C14SR; Putative sterol reductase SR-1; Sterol C14-reductase; Transmembrane 7 superfamily member 2
• Gene Name: TM7SF2
• Related Disease:
  Carcinoma
  Adult glioblastoma
  Adult respiratory distress syndrome
  Advanced cancer
  Alzheimer disease
  Arteriosclerosis
  Arthritis
  Astrocytoma
  Atherosclerosis
  Breast cancer
  Breast carcinoma
  Classic Hodgkin lymphoma
  Colon cancer
  Colon carcinoma
  Dilated cardiomyopathy 1A
  Gastric cancer
  Glioblastoma multiforme
  Huntington disease
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Mesothelioma
  Metabolic disorder
  Metastatic malignant neoplasm
  Myocardial infarction
  Neoplasm
  Nephropathy
  Non-small-cell lung cancer
  Obesity
  Osteoporosis
  Pneumonia
  Pneumonitis
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Rheumatoid arthritis
  Stroke
  Type-1/2 diabetes
  Cardiovascular disease
  Cardiac failure
  Congestive heart failure
  Pulmonary fibrosis
  Acute myocardial infarction
  Asthma
  Cognitive impairment
  Colitis
  Non-insulin dependent diabetes
  Pancreatic cancer
  Vascular disease
• UniProt ID: ERG24_HUMAN
• EC Number: 1.3.1.70
• Pfam ID: PF01222
• Sequence:
  MAPTQGPRAPLEFGGPLGAAALLLLLPATMFHLLLAARSGPARLLGPPASLPGLEVLWSP
  RALLLWLAWLGLQAALYLLPARKVAEGQELKDKSRLRYPINGFQALVLTALLVGLGMSAG
  LPLGALPEMLLPLAFVATLTAFIFSLFLYMKAQVAPVSALAPGGNSGNPIYDFFLGRELN
  PRICFFDFKYFCELRPGLIGWVLINLALLMKEAELRGSPSLAMWLVNGFQLLYVGDALWH
  EEAVLTTMDITHDGFGFMLAFGDMAWVPFTYSLQAQFLLHHPQPLGLPMASVICLINATG
  YYIFRGANSQKNTFRKNPSDPRVAGLETISTATGRKLLVSGWWGMVRHPNYLGDLIMALA
  WSLPCGVSHLLPYFYLLYFTALLVHREARDERQCLQKYGLAWQEYCRRVPYRIMPYIY
• Function: Catalyzes the reduction of the C14-unsaturated bond of lanosterol, as part of the metabolic pathway leading to cholesterol biosynthesis.
• Tissue Specificity: Expressed in adult heart, brain, pancreas, lung, liver, skeletal muscle, kidney, ovary, prostate, testis and adrenal gland, but not detected in placenta, spleen, thymus, small intestine, colon (mucosal lining), or peripheral blood leukocytes.
• KEGG Pathway:
  Steroid biosynthesis (hsa00100)
  Metabolic pathways (hsa01100)
• Reactome Pathway:
  Activation of gene expression by SREBF (SREBP) (R-HSA-2426168)
  Cholesterol biosynthesis (R-HSA-191273)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma	DISH9F1N	Definitive	Altered Expression	[1]
Adult glioblastoma	DISVP4LU	Strong	Genetic Variation	[2]
Adult respiratory distress syndrome	DISIJV47	Strong	Biomarker	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[5]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[6]
Arthritis	DIST1YEL	Strong	Genetic Variation	[7]
Astrocytoma	DISL3V18	Strong	Biomarker	[8]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[10]
Colon cancer	DISVC52G	Strong	Biomarker	[11]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[11]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Biomarker	[12]
Gastric cancer	DISXGOUK	Strong	Biomarker	[13]
Glioblastoma multiforme	DISK8246	Strong	Genetic Variation	[2]
Huntington disease	DISQPLA4	Strong	Biomarker	[10]
Lung cancer	DISCM4YA	Strong	Biomarker	[14]
Lung carcinoma	DISTR26C	Strong	Biomarker	[14]
Lung neoplasm	DISVARNB	Strong	Biomarker	[15]
Mesothelioma	DISKWK9M	Strong	Altered Expression	[16]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[17]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[18]
Myocardial infarction	DIS655KI	Strong	Biomarker	[19]
Neoplasm	DISZKGEW	Strong	Biomarker	[9]
Nephropathy	DISXWP4P	Strong	Biomarker	[20]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[21]
Obesity	DIS47Y1K	Strong	Biomarker	[17]
Osteoporosis	DISF2JE0	Strong	Biomarker	[22]
Pneumonia	DIS8EF3M	Strong	Biomarker	[23]
Pneumonitis	DIS88E0K	Strong	Biomarker	[23]
Prostate cancer	DISF190Y	Strong	Altered Expression	[24]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[24]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[25]
Rheumatoid arthritis	DISTSB4J	Strong	Altered Expression	[26]
Stroke	DISX6UHX	Strong	Biomarker	[27]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[28]
Cardiovascular disease	DIS2IQDX	moderate	Biomarker	[29]
Cardiac failure	DISDC067	Disputed	Biomarker	[30]
Congestive heart failure	DIS32MEA	Disputed	Biomarker	[30]
Pulmonary fibrosis	DISQKVLA	Disputed	Biomarker	[23]
Acute myocardial infarction	DISE3HTG	Limited	Genetic Variation	[31]
Asthma	DISW9QNS	Limited	Biomarker	[32]
Cognitive impairment	DISH2ERD	Limited	Biomarker	[33]
Colitis	DISAF7DD	Limited	Biomarker	[34]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[17]
Pancreatic cancer	DISJC981	Limited	Altered Expression	[35]
Vascular disease	DISVS67S	Limited	Biomarker	[36]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[37]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[38]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[39]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[40]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[41]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[42]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[43]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[44]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[43]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[45]
Capsaicin	DMGMF6V	Approved	Capsaicin decreases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[46]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[47]
Isoflavone	DM7U58J	Phase 4	Isoflavone affects the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[48]
GSK2110183	DMZHB37	Phase 2	GSK2110183 increases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[49]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[50]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[51]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[52]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[53]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[54]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Delta(14)-sterol reductase TM7SF2 (TM7SF2).	[55]

References

• [1] Alteration of the vascular endothelial growth factor and angiopoietins-1 and -2 pathways in transitional cell carcinomas of the urinary bladder associated with tumor progression.Anticancer Res. 2004 Sep-Oct;24(5A):2745-56.
• [2] Suppression of Angiotensin-(1-7) on the Disruption of Blood-Brain Barrier in Rat of Brain Glioma.Pathol Oncol Res. 2019 Jan;25(1):429-435. doi: 10.1007/s12253-018-0471-z. Epub 2018 Sep 18.
• [3] Activating Mas receptor protects human pulmonary microvascular endothelial cells against LPS-induced apoptosis via the NF-kB p65/P53 feedback pathways.J Cell Physiol. 2019 Aug;234(8):12865-12875. doi: 10.1002/jcp.27951. Epub 2018 Dec 7.
• [4] Mir-513a-3p contributes to the controlling of cellular migration processes in the A549 lung tumor cells by modulating integrin -8 expression.Mol Cell Biochem. 2018 Jul;444(1-2):43-52. doi: 10.1007/s11010-017-3229-0. Epub 2017 Dec 4.
• [5] Cerebrospinal Fluid Changes in the Renin-Angiotensin System in Alzheimer's Disease.J Alzheimers Dis. 2019;72(2):525-535. doi: 10.3233/JAD-190721.
• [6] Angiopoietin-1 aggravates atherosclerosis by inhibiting cholesterol efflux and promoting inflammatory response.Biochim Biophys Acta Mol Cell Biol Lipids. 2020 Feb;1865(2):158535. doi: 10.1016/j.bbalip.2019.158535. Epub 2019 Oct 31.
• [7] Angiotensin-(1-7) Promotes Resolution of Neutrophilic Inflammation in a Model of Antigen-Induced Arthritis in Mice.Front Immunol. 2017 Nov 20;8:1596. doi: 10.3389/fimmu.2017.01596. eCollection 2017.
• [8] Role of Ang1 and its interaction with VEGF-A in astrocytomas.J Neuropathol Exp Neurol. 2004 Sep;63(9):978-89. doi: 10.1093/jnen/63.9.978.
• [9] Angiotensin 1-7 formation in breast tissue is attenuated in breast cancer - a study on the metabolism of angiotensinogen in breast cancer cell lines.J Physiol Pharmacol. 2019 Aug;70(4). doi: 10.26402/jpp.2019.4.02. Epub 2019 Oct 19.
• [10] Circulating miR-421 Targeting Leucocytic Angiotensin Converting Enzyme 2 Is Elevated in Patients with Chronic Kidney Disease.Nephron. 2019;141(1):61-74. doi: 10.1159/000493805. Epub 2018 Oct 16.
• [11] Expression of angiogenic growth factors VEGF, bFGF and ANG1 in colon cancer after bevacizumab treatment in vitro: A potential self-regulating mechanism.Oncol Rep. 2017 Jan;37(1):601-607. doi: 10.3892/or.2016.5231. Epub 2016 Nov 8.
• [12] Neuregulin-1 Promotes Myocardial Angiogenesis in the Rat Model of Diabetic Cardiomyopathy.Cell Physiol Biochem. 2018;46(6):2325-2334. doi: 10.1159/000489622. Epub 2018 May 4.
• [13] Expression of angiopoietin 1, 2 and their common receptor Tie2 in human gastric carcinoma: implication for angiogenesis.J Korean Med Sci. 2006 Apr;21(2):272-8. doi: 10.3346/jkms.2006.21.2.272.
• [14] AAV-Mediated angiotensin 1-7 overexpression inhibits tumor growth of lung cancer in vitro and in vivo.Oncotarget. 2017 Jan 3;8(1):354-363. doi: 10.18632/oncotarget.13396.
• [15] Angiotensin-(1-7) inhibits tumor angiogenesis in human lung cancer xenografts with a reduction in vascular endothelial growth factor.Mol Cancer Ther. 2009 Jun;8(6):1676-83. doi: 10.1158/1535-7163.MCT-09-0161. Epub 2009 Jun 9.
• [16] Role of angiopoietins in mesothelioma progression.Cytokine. 2019 Jun;118:99-106. doi: 10.1016/j.cyto.2018.08.006. Epub 2018 Sep 7.
• [17] Angiotensin-(1-7), Adipokines and Inflammation.Metabolism. 2019 Jun;95:36-45. doi: 10.1016/j.metabol.2019.03.006. Epub 2019 Mar 21.
• [18] The association of the angiopoietin/Tie-2 system with the development of metastasis and leukocyte migration in neuroendocrine tumors.Endocr Relat Cancer. 2010 Oct 5;17(4):897-908. doi: 10.1677/ERC-10-0020. Print 2010 Dec.
• [19] Angiotensin-(1-7) oral treatment after experimental myocardial infarction leads to downregulation of CXCR4.J Proteomics. 2019 Sep 30;208:103486. doi: 10.1016/j.jprot.2019.103486. Epub 2019 Aug 19.
• [20] Molecular and Cellular Effect of Angiotensin 1-7 on Hypertensive Kidney Disease.Am J Hypertens. 2019 Apr 22;32(5):460-467. doi: 10.1093/ajh/hpz009.
• [21] Treatment with EGCG in NSCLC leads to decreasing interstitial fluid pressure and hypoxia to improve chemotherapy efficacy through rebalance of Ang-1 and Ang-2.Chin J Nat Med. 2013 May;11(3):245-53. doi: 10.1016/S1875-5364(13)60023-0.
• [22] The angiotensin converting enzyme 2/angiotensin-(1-7)/Mas Receptor axis as a key player in alveolar bone remodeling.Bone. 2019 Nov;128:115041. doi: 10.1016/j.bone.2019.115041. Epub 2019 Aug 20.
• [23] Effect of preventive or therapeutic treatment with angiotensin 1-7 in a model of bleomycin-induced lung fibrosis in mice.J Leukoc Biol. 2019 Sep;106(3):677-686. doi: 10.1002/JLB.MA1218-490RR. Epub 2019 Jun 30.
• [24] Effects of testosterone and 17estradiol on angiotensininduced changes in tyrosine kinase activity in the androgenindependent human prostate cancer cell line, DU145.Int J Mol Med. 2017 Nov;40(5):1573-1581. doi: 10.3892/ijmm.2017.3149. Epub 2017 Sep 25.
• [25] Unique angiogenic and vasculogenic properties of renal cell carcinoma in a xenograft model of bone metastasis are associated with high levels of vegf-a and decreased ang-1 expression.J Orthop Res. 2012 Feb;30(2):325-33. doi: 10.1002/jor.21500. Epub 2011 Aug 1.
• [26] Angiopoietin-2 promotes inflammatory activation of human macrophages and is essential for murine experimental arthritis.Ann Rheum Dis. 2012 Aug;71(8):1402-10. doi: 10.1136/annrheumdis-2011-200718. Epub 2012 Jun 22.
• [27] Assessing the effects of Ang-(1-7) therapy following transient middle cerebral artery occlusion.Sci Rep. 2019 Feb 28;9(1):3154. doi: 10.1038/s41598-019-39102-8.
• [28] Angiotensin II type 2 receptor and angiotensin-converting enzyme 2 mediate ischemic renal injury in diabetic and non-diabetic rats.Life Sci. 2019 Oct 15;235:116796. doi: 10.1016/j.lfs.2019.116796. Epub 2019 Aug 27.
• [29] Relationship between circulating levels of angiotensin-converting enzyme 2-angiotensin-(1-7)-MAS axis and coronary heart disease.Heart Vessels. 2020 Feb;35(2):153-161. doi: 10.1007/s00380-019-01478-y. Epub 2019 Jul 29.
• [30] Reversal of angiotensin-(1-12)-caused positive modulation on left ventricular contractile performance in heart failure: Assessment by pressure-volume analysis.Int J Cardiol. 2020 Feb 15;301:135-141. doi: 10.1016/j.ijcard.2019.09.004. Epub 2019 Sep 6.
• [31] Dual delivery of VEGF and ANG-1 in ischemic hearts using an injectable hydrogel.Acta Biomater. 2017 Jan 15;48:58-67. doi: 10.1016/j.actbio.2016.10.013. Epub 2016 Oct 15.
• [32] Ang-(1-7)/ MAS1 receptor axis inhibits allergic airway inflammation via blockade of Src-mediated EGFR transactivation in a murine model of asthma.PLoS One. 2019 Nov 1;14(11):e0224163. doi: 10.1371/journal.pone.0224163. eCollection 2019.
• [33] Stimulation of ACE2/ANG(1-7)/Mas Axis by Diminazene Ameliorates Alzheimer's Disease in the D-Galactose-Ovariectomized Rat Model: Role of PI3K/Akt Pathway.Mol Neurobiol. 2018 Oct;55(10):8188-8202. doi: 10.1007/s12035-018-0966-3. Epub 2018 Mar 7.
• [34] COMP-angiopoietin-1 ameliorates inflammation-induced lymphangiogenesis in dextran sulfate sodium (DSS)-induced colitis model.J Mol Med (Berl). 2018 May;96(5):459-467. doi: 10.1007/s00109-018-1633-x. Epub 2018 Apr 2.
• [35] Angiogenesis in adenosquamous cancer of pancreas.Oncotarget. 2017 Sep 27;8(56):95773-95779. doi: 10.18632/oncotarget.21319. eCollection 2017 Nov 10.
• [36] Orchestral actions of angiopoietin-1 in vascular regeneration.Trends Mol Med. 2013 Jan;19(1):31-9. doi: 10.1016/j.molmed.2012.10.010. Epub 2012 Nov 23.
• [37] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [38] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [39] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [40] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [41] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [42] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [43] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [44] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [45] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [46] Induction of the endoplasmic reticulum stress protein GADD153/CHOP by capsaicin in prostate PC-3 cells: a microarray study. Biochem Biophys Res Commun. 2008 Aug 8;372(4):785-91.
• [47] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [48] Soy isoflavones alter expression of genes associated with cancer progression, including interleukin-8, in androgen-independent PC-3 human prostate cancer cells. J Nutr. 2006 Jan;136(1):75-82.
• [49] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [50] Gene expression preferentially regulated by tamoxifen in breast cancer cells and correlations with clinical outcome. Cancer Res. 2006 Jul 15;66(14):7334-40.
• [51] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [52] BET bromodomain inhibition targets both c-Myc and IL7R in high-risk acute lymphoblastic leukemia. Blood. 2012 Oct 4;120(14):2843-52.
• [53] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [54] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [55] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.