Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQK7M9V)

• DOT Name: MAPK/MAK/MRK overlapping kinase (MOK)
• Synonyms: EC 2.7.11.22; MOK protein kinase; Renal tumor antigen 1; RAGE-1
• Gene Name: MOK
• Related Disease:
  Lung adenocarcinoma
  Pancreatic cancer
  Type-1 diabetes
  Acute myelogenous leukaemia
  Adenoma
  Advanced cancer
  Amyloidosis
  Cardiac failure
  Clear cell renal carcinoma
  Congestive heart failure
  Dementia
  Diabetic retinopathy
  Hepatocellular carcinoma
  High blood pressure
  Huntington disease
  Hyperglycemia
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Neoplasm
  Nephropathy
  Neuroblastoma
  Non-alcoholic fatty liver disease
  Obesity
  Osteoarthritis
  Parkinson disease
  Polycystic ovarian syndrome
  Rheumatoid arthritis
  Squamous cell carcinoma
  Type-1/2 diabetes
  Ulcerative colitis
  Amyotrophic lateral sclerosis
  Asthma
  Chronic kidney disease
  Diabetic kidney disease
  Metastatic malignant neoplasm
  Multiple sclerosis
  Nasopharyngeal carcinoma
  Non-small-cell lung cancer
  Pulmonary fibrosis
  Triple negative breast cancer
  Melanoma
  Arthritis
  Chronic obstructive pulmonary disease
  Myocardial infarction
  Non-insulin dependent diabetes
  Osteoporosis
  Renal cell carcinoma
• UniProt ID: MOK_HUMAN
• EC Number: 2.7.11.22
• Pfam ID: PF00069
• Sequence:
  MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPH
  PNILMLHEVVFDRKSGSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIH
  RNGIFHRDVKPENILIKQDVLKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYT
  YKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPAQKILTKFKQSRAMNFDFP
  FKKGSGIPLLTTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRKTEKRALGSHR
  KAGFPEHPVAPEPLSNSCQISKEGRKQKQSLKQEEDRPKRRGPAYVMELPKLKLSGVVRL
  SSYSSPTLQSVLGSGTNGRVPVLRPLKCIPASKKTDPQKDLKPAPQQCRLPTIVRKGGR
• Function: Able to phosphorylate several exogenous substrates and to undergo autophosphorylation. Negatively regulates cilium length in a cAMP and mTORC1 signaling-dependent manner.
• Tissue Specificity: Expressed in heart, brain, lung, kidney, and pancreas, and at very low levels in placenta, liver and skeletal muscle. Detected in retina.

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Definitive	Biomarker	[1]
Pancreatic cancer	DISJC981	Definitive	Biomarker	[2]
Type-1 diabetes	DIS7HLUB	Definitive	Biomarker	[3]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[4]
Adenoma	DIS78ZEV	Strong	Altered Expression	[5]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[6]
Amyloidosis	DISHTAI2	Strong	Biomarker	[7]
Cardiac failure	DISDC067	Strong	Biomarker	[8]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[9]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[8]
Dementia	DISXL1WY	Strong	Genetic Variation	[10]
Diabetic retinopathy	DISHGUJM	Strong	Genetic Variation	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[12]
High blood pressure	DISY2OHH	Strong	Altered Expression	[13]
Huntington disease	DISQPLA4	Strong	Altered Expression	[14]
Hyperglycemia	DIS0BZB5	Strong	Biomarker	[15]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[16]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[16]
Lung neoplasm	DISVARNB	Strong	Altered Expression	[17]
Neoplasm	DISZKGEW	Strong	Biomarker	[18]
Nephropathy	DISXWP4P	Strong	Biomarker	[19]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[20]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[21]
Obesity	DIS47Y1K	Strong	Biomarker	[22]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[23]
Parkinson disease	DISQVHKL	Strong	Biomarker	[24]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[25]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[26]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[27]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[28]
Ulcerative colitis	DIS8K27O	Strong	Genetic Variation	[29]
Amyotrophic lateral sclerosis	DISF7HVM	moderate	Biomarker	[30]
Asthma	DISW9QNS	moderate	Biomarker	[31]
Chronic kidney disease	DISW82R7	moderate	Biomarker	[32]
Diabetic kidney disease	DISJMWEY	moderate	Biomarker	[33]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[34]
Multiple sclerosis	DISB2WZI	moderate	Biomarker	[35]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Altered Expression	[36]
Non-small-cell lung cancer	DIS5Y6R9	moderate	Biomarker	[37]
Pulmonary fibrosis	DISQKVLA	moderate	Biomarker	[38]
Triple negative breast cancer	DISAMG6N	moderate	Altered Expression	[39]
Melanoma	DIS1RRCY	Disputed	Biomarker	[40]
Arthritis	DIST1YEL	Limited	Biomarker	[41]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Biomarker	[42]
Myocardial infarction	DIS655KI	Limited	Genetic Variation	[43]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[44]
Osteoporosis	DISF2JE0	Limited	Altered Expression	[45]
Renal cell carcinoma	DISQZ2X8	Limited	Biomarker	[9]

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	MAPK/MAK/MRK overlapping kinase (MOK) affects the response to substance of Paclitaxel.	[56]
Mitomycin	DMH0ZJE	Approved	MAPK/MAK/MRK overlapping kinase (MOK) affects the response to substance of Mitomycin.	[56]
Topotecan	DMP6G8T	Approved	MAPK/MAK/MRK overlapping kinase (MOK) affects the response to substance of Topotecan.	[56]
Vinblastine	DM5TVS3	Approved	MAPK/MAK/MRK overlapping kinase (MOK) affects the response to substance of Vinblastine.	[56]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of MAPK/MAK/MRK overlapping kinase (MOK).	[46]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of MAPK/MAK/MRK overlapping kinase (MOK).	[55]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of MAPK/MAK/MRK overlapping kinase (MOK).	[47]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of MAPK/MAK/MRK overlapping kinase (MOK).	[48]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of MAPK/MAK/MRK overlapping kinase (MOK).	[49]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of MAPK/MAK/MRK overlapping kinase (MOK).	[50]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of MAPK/MAK/MRK overlapping kinase (MOK).	[51]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of MAPK/MAK/MRK overlapping kinase (MOK).	[52]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of MAPK/MAK/MRK overlapping kinase (MOK).	[53]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of MAPK/MAK/MRK overlapping kinase (MOK).	[54]

References

• [1] High glucose promotes tumor cell proliferation and migration in lung adenocarcinoma via the RAGENOXs pathway.Mol Med Rep. 2018 Jun;17(6):8536-8541. doi: 10.3892/mmr.2018.8914. Epub 2018 Apr 23.
• [2] The marine natural product Scalarin inhibits the receptor for advanced glycation end products (RAGE) and autophagy in the PANC-1 and MIA PaCa-2 pancreatic cancer cell lines.Invest New Drugs. 2019 Apr;37(2):262-270. doi: 10.1007/s10637-018-0635-4. Epub 2018 Jul 12.
• [3] Dietary advanced glycated end-products and medicines influence the expression of SIRT1 and DDOST in peripheral mononuclear cells from long-term type 1 diabetes patients.Diab Vasc Dis Res. 2018 Jan;15(1):81-89. doi: 10.1177/1479164117733918. Epub 2017 Oct 13.
• [4] Targeting the arginine metabolic brake enhances immunotherapy for leukaemia.Int J Cancer. 2019 Oct 15;145(8):2201-2208. doi: 10.1002/ijc.32028. Epub 2019 Jan 11.
• [5] Distinct expression patterns of ICK/MAK/MOK protein kinases in the intestine implicate functional diversity.PLoS One. 2013 Nov 7;8(11):e79359. doi: 10.1371/journal.pone.0079359. eCollection 2013.
• [6] Association of RAGE rs1800625 Polymorphism and Cancer Risk: A Meta-Analysis of 18 Case-Control Studies.Med Sci Monit. 2019 Sep 19;25:7026-7034. doi: 10.12659/MSM.916260.
• [7] Entorhinal Cortex dysfunction can be rescued by inhibition of microglial RAGE in an Alzheimer's disease mouse model.Sci Rep. 2017 Feb 13;7:42370. doi: 10.1038/srep42370.
• [8] The different roles for the advanced glycation end products axis in heart failure and acute coronary syndrome settings.Nutr Metab Cardiovasc Dis. 2019 Oct;29(10):1050-1060. doi: 10.1016/j.numecd.2019.06.014. Epub 2019 Jun 22.
• [9] HMGB1/RAGE axis mediates the apoptosis, invasion, autophagy, and angiogenesis of the renal cell carcinoma.Onco Targets Ther. 2018 Aug 1;11:4501-4510. doi: 10.2147/OTT.S167197. eCollection 2018.
• [10] G82S polymorphism of receptor for advanced glycation end products gene and serum soluble RAGE levels in mild cognitive impairment and dementia of Alzheimer's type patients in Turkish population.J Clin Neurosci. 2019 Jan;59:197-201. doi: 10.1016/j.jocn.2018.10.072. Epub 2018 Oct 30.
• [11] Receptor for advanced glycation end-product (RAGE) gene polymorphism 2245G/A is associated with pro-inflammatory, oxidative-glycation markers and sRAGE in diabetic retinopathy.Gene. 2013 Jun 1;521(2):227-33. doi: 10.1016/j.gene.2013.03.062. Epub 2013 Mar 29.
• [12] Circular RNA 101368/miR-200a axis modulates the migration of hepatocellular carcinoma through HMGB1/RAGE signaling.Cell Cycle. 2018;17(19-20):2349-2359. doi: 10.1080/15384101.2018.1526599. Epub 2018 Oct 22.
• [13] Hypertension accelerates age-related intrarenal small artery (IRSA) remodelling and stiffness in rats with possible involvement of AGEs and RAGE.Histol Histopathol. 2020 Jan;35(1):97-109. doi: 10.14670/HH-18-141. Epub 2019 Jun 27.
• [14] Receptor for Advanced Glycation End Products (RAGE) is Expressed Predominantly in Medium Spiny Neurons of tgHD Rat Striatum.Neuroscience. 2018 Jun 1;380:146-151. doi: 10.1016/j.neuroscience.2018.03.042. Epub 2018 Apr 4.
• [15] Type 2 Diabetes Mellitus Increases The Risk of Late-Onset Alzheimer's Disease: Ultrastructural Remodeling of the Neurovascular Unit and Diabetic Gliopathy.Brain Sci. 2019 Sep 29;9(10):262. doi: 10.3390/brainsci9100262.
• [16] RAGE may act as a tumour suppressor to regulate lung cancer development.Gene. 2018 Apr 20;651:86-93. doi: 10.1016/j.gene.2018.02.009. Epub 2018 Feb 5.
• [17] RAGE: a new pleiotropic antagonistic gene?.Ann N Y Acad Sci. 2004 Jun;1019:228-31. doi: 10.1196/annals.1297.038.
• [18] Neutrophil Cathepsin G and Tumor Cell RAGE Facilitate Neutrophil Anti-Tumor Cytotoxicity.Oncoimmunology. 2019 Jun 11;8(9):e1624129. doi: 10.1080/2162402X.2019.1624129. eCollection 2019.
• [19] Receptor for Advanced Glycation End Products Antagonism Blunts Kidney Damage in Transgenic Townes Sickle Mice.Front Physiol. 2019 Jul 23;10:880. doi: 10.3389/fphys.2019.00880. eCollection 2019.
• [20] Receptor-mediated toxicity of human amylin fragment aggregated by short- and long-term incubations with copper ions.Mol Cell Biochem. 2017 Jan;425(1-2):85-93. doi: 10.1007/s11010-016-2864-1. Epub 2016 Nov 1.
• [21] Serum levels of advanced glycation end-products (AGEs) and the decoy soluble receptor for AGEs (sRAGE) can identify non-alcoholic fatty liver disease in age-, sex- and BMI-matched normo-glycemic adults.Metabolism. 2018 Jun;83:120-127. doi: 10.1016/j.metabol.2018.01.023. Epub 2018 Feb 2.
• [22] Expression of the receptor of advanced glycation end-products (RAGE) and membranal location in peripheral blood mononuclear cells (PBMC) in obesity and insulin resistance.Iran J Basic Med Sci. 2019 Jun;22(6):623-630. doi: 10.22038/ijbms.2019.34571.8206.
• [23] Vascular Adhesion Protein-1 (VAP-1) as Predictor of Radiographic Severity in Symptomatic Knee Osteoarthritis in the New York University Cohort.Int J Mol Sci. 2019 May 29;20(11):2642. doi: 10.3390/ijms20112642.
• [24] RAGE and its emerging role in the pathogenesis of Parkinson's disease.Neurosci Lett. 2018 Apr 13;672:65-69. doi: 10.1016/j.neulet.2018.02.049. Epub 2018 Mar 21.
• [25] An inverse association between serum soluble receptor of advanced glycation end products and hyperandrogenism and potential implication in polycystic ovary syndrome patients.Reprod Biol Endocrinol. 2017 Jan 26;15(1):9. doi: 10.1186/s12958-017-0227-8.
• [26] HMGB1-LPS complex promotes transformation of osteoarthritis synovial fibroblasts to a rheumatoid arthritis synovial fibroblast-like phenotype.Cell Death Dis. 2014 Feb 20;5(2):e1077. doi: 10.1038/cddis.2014.48.
• [27] Clinical Implications of High-mobility Group Box-1 (HMGB1) and the Receptor for Advanced Glycation End-products (RAGE) in Cutaneous Malignancy: A Systematic Review.Anticancer Res. 2017 Jan;37(1):1-7. doi: 10.21873/anticanres.11282.
• [28] Diabetes Mellitus and Cardiovascular Disease.Arterioscler Thromb Vasc Biol. 2019 Apr;39(4):558-568. doi: 10.1161/ATVBAHA.119.310961.
• [29] Genetic polymorphisms of RAGE and risk of ulcerative colitis in a Chinese population.Immunol Lett. 2016 Feb;170:88-94. doi: 10.1016/j.imlet.2015.09.003. Epub 2015 Sep 5.
• [30] Nitration and Glycation Turn Mature NGF into a Toxic Factor for Motor Neurons: A Role for p75(NTR) and RAGE Signaling in ALS.Antioxid Redox Signal. 2018 Jun 20;28(18):1587-1602. doi: 10.1089/ars.2016.6966. Epub 2017 Jun 26.
• [31] Effects of epigallocatechin-3-gallate on the HMGB1/RAGE pathway in PM(2.5)-exposed asthmatic rats.Biochem Biophys Res Commun. 2019 Jun 11;513(4):898-903. doi: 10.1016/j.bbrc.2019.03.165. Epub 2019 Apr 16.
• [32] Advanced glycation end products in the pathogenesis of chronic kidney disease.Kidney Int. 2018 Apr;93(4):803-813. doi: 10.1016/j.kint.2017.11.034. Epub 2018 Feb 22.
• [33] Contribution of myo-inositol oxygenase in AGE:RAGE-mediated renal tubulointerstitial injury in the context of diabetic nephropathy.Am J Physiol Renal Physiol. 2018 Jan 1;314(1):F107-F121. doi: 10.1152/ajprenal.00434.2017. Epub 2017 Sep 20.
• [34] Silencing of advanced glycosylation and glycosylation and product-specific receptor (RAGE) inhibits the metastasis and growth of non-small cell lung cancer.Am J Transl Res. 2017 Jun 15;9(6):2760-2774. eCollection 2017.
• [35] Methylglyoxal-Derived Advanced Glycation Endproducts Accumulate in Multiple Sclerosis Lesions.Front Immunol. 2019 Apr 24;10:855. doi: 10.3389/fimmu.2019.00855. eCollection 2019.
• [36] Dione-thiophene conjugate inhibits proliferation and metastasis of nasopharyngeal carcinoma cells through calcium binding protein-P down-regulation.Eur J Med Chem. 2019 Apr 15;168:199-206. doi: 10.1016/j.ejmech.2019.01.051. Epub 2019 Jan 25.
• [37] Ethyl pyruvate suppresses the growth, invasion and migration and induces the apoptosis of nonsmall cell lung cancer cells via the HMGB1/RAGE axis and the NFB/STAT3 pathway.Oncol Rep. 2019 Aug;42(2):817-825. doi: 10.3892/or.2019.7176. Epub 2019 May 30.
• [38] miR-627/HMGB1/NF-B regulatory loop modulates TGF-1-induced pulmonary fibrosis.J Cell Biochem. 2019 Mar;120(3):2983-2993. doi: 10.1002/jcb.27038. Epub 2018 Dec 9.
• [39] Targeting AXL and RAGE to prevent geminin overexpression-induced triple-negative breast cancer metastasis.Sci Rep. 2019 Dec 16;9(1):19150. doi: 10.1038/s41598-019-55702-w.
• [40] Ousting RAGE in melanoma: A viable therapeutic target?.Semin Cancer Biol. 2018 Apr;49:20-28. doi: 10.1016/j.semcancer.2017.10.008. Epub 2017 Oct 24.
• [41] TREM-1, HMGB1 and RAGE in the Shoulder Tendon: Dual Mechanisms for Inflammation Based on the Coincidence of Glenohumeral Arthritis.PLoS One. 2016 Oct 28;11(10):e0165492. doi: 10.1371/journal.pone.0165492. eCollection 2016.
• [42] Receptor for advanced glycation end-products and environmental exposure related obstructive airways disease: a systematic review.Eur Respir Rev. 2019 Mar 27;28(151):180096. doi: 10.1183/16000617.0096-2018. Print 2019 Mar 31.
• [43] Predictive Nomogram of RAGE Genetic Polymorphisms and Metabolic Risk Factors for Myocardial Infarction Risk in a Han Chinese Population.Angiology. 2017 Nov;68(10):877-883. doi: 10.1177/0003319717696622. Epub 2017 Mar 10.
• [44] Effect of Irbesartan on AGEs-RAGE and MMPs systems in rat type 2 diabetes myocardial-fibrosis model.Exp Biol Med (Maywood). 2019 May;244(7):612-620. doi: 10.1177/1535370219840981. Epub 2019 Apr 26.
• [45] Effects of GLP-1 receptor analogue liraglutide and DPP-4 inhibitor vildagliptin on the bone metabolism in ApoE(-/-) mice.Ann Transl Med. 2019 Aug;7(16):369. doi: 10.21037/atm.2019.06.74.
• [46] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [47] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [48] Benzodithiophenes potentiate differentiation of acute promyelocytic leukemia cells by lowering the threshold for ligand-mediated corepressor/coactivator exchange with retinoic acid receptor alpha and enhancing changes in all-trans-retinoic acid-regulated gene expression. Cancer Res. 2005 Sep 1;65(17):7856-65. doi: 10.1158/0008-5472.CAN-05-1056.
• [49] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [50] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [51] Bisphenol-A and estradiol exert novel gene regulation in human MCF-7 derived breast cancer cells. Mol Cell Endocrinol. 2004 Jun 30;221(1-2):47-55. doi: 10.1016/j.mce.2004.04.010.
• [52] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [53] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [54] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [55] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [56] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.