Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTGM9NK)

• DOT Name: CCHC-type zinc finger nucleic acid binding protein (CNBP)
• Synonyms: Cellular nucleic acid-binding protein; CNBP; Zinc finger protein 9
• Gene Name: CNBP
• Related Disease:
  Diabetic retinopathy
  Gastric cancer
  Myotonic dystrophy type 2
  Neuroblastoma
  Parkinson disease
  Stomach cancer
  Thyroid gland papillary carcinoma
  Acute erythroid leukemia
  Adult glioblastoma
  Arteriosclerosis
  Atherosclerosis
  Brain neoplasm
  Breast cancer
  Breast carcinoma
  Colon cancer
  Colorectal carcinoma
  Dengue
  Depression
  Diabetic kidney disease
  Fibrosarcoma
  Glioblastoma multiforme
  Hepatitis C virus infection
  Hepatocellular carcinoma
  High blood pressure
  Hyperinsulinemia
  Hyperlipidemia
  Hypothyroidism
  Immune system disorder
  Immunodeficiency
  Metabolic disorder
  Neoplasm
  Non-alcoholic fatty liver disease
  Non-insulin dependent diabetes
  Obesity
  Renal fibrosis
  Schizophrenia
  Trichohepatoenteric syndrome
  Type-1/2 diabetes
  B-cell neoplasm
  Endometrial carcinoma
  Hypoglycemia
  Lipodystrophy
  Osteoarthritis
  Pancreatic cancer
  Advanced cancer
  Coronary atherosclerosis
  Coronary heart disease
  Hyperglycemia
  Inflammation
  Myotonic dystrophy type 1
• UniProt ID: CNBP_HUMAN
• Pfam ID: PF00098
• Sequence:
  MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGES
  GHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCY
  SCGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA
• Function: Single-stranded DNA-binding protein that preferentially binds to the sterol regulatory element (SRE) sequence 5'-GTGCGGTG-3', and thereby mediates transcriptional repression. Has a role as transactivator of the Myc promoter. Binds single-stranded RNA in a sequence-specific manner; [Isoform 1]: Binds G-rich elements in target mRNA coding sequences. Prevents G-quadruplex structure formation in vitro, suggesting a role in supporting translation by resolving stable structures on mRNAs ; [Isoform 2]: Binds to RNA; [Isoform 4]: Binds to RNA; [Isoform 5]: Binds to RNA; [Isoform 6]: Binds to RNA; [Isoform 8]: Binds to RNA.
• Tissue Specificity: Expressed in the liver, kidney, spleen, testis, lung, muscle and adrenal glands.
• Reactome Pathway: SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671)

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Diabetic retinopathy	DISHGUJM	Definitive	Biomarker	[1]
Gastric cancer	DISXGOUK	Definitive	Altered Expression	[2]
Myotonic dystrophy type 2	DIS5ZWF1	Definitive	Autosomal dominant	[3]
Neuroblastoma	DISVZBI4	Definitive	Altered Expression	[4]
Parkinson disease	DISQVHKL	Definitive	Biomarker	[4]
Stomach cancer	DISKIJSX	Definitive	Altered Expression	[2]
Thyroid gland papillary carcinoma	DIS48YMM	Definitive	Biomarker	[5]
Acute erythroid leukemia	DISZFC1O	Strong	Altered Expression	[6]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[7]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[8]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[8]
Brain neoplasm	DISY3EKS	Strong	Altered Expression	[7]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[9]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[9]
Colon cancer	DISVC52G	Strong	Altered Expression	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[11]
Dengue	DISKH221	Strong	Biomarker	[12]
Depression	DIS3XJ69	Strong	Biomarker	[13]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[14]
Fibrosarcoma	DISWX7MU	Strong	Altered Expression	[15]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[7]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[16]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[17]
High blood pressure	DISY2OHH	Strong	Altered Expression	[18]
Hyperinsulinemia	DISIDWT6	Strong	Biomarker	[19]
Hyperlipidemia	DIS61J3S	Strong	Altered Expression	[20]
Hypothyroidism	DISR0H6D	Strong	Biomarker	[21]
Immune system disorder	DISAEGPH	Strong	Genetic Variation	[22]
Immunodeficiency	DIS093I0	Strong	Altered Expression	[22]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[13]
Neoplasm	DISZKGEW	Strong	Altered Expression	[2]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Altered Expression	[23]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[24]
Obesity	DIS47Y1K	Strong	Biomarker	[25]
Renal fibrosis	DISMHI3I	Strong	Biomarker	[14]
Schizophrenia	DISSRV2N	Strong	Biomarker	[26]
Trichohepatoenteric syndrome	DISL3ODF	Strong	Biomarker	[27]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[28]
B-cell neoplasm	DISVY326	moderate	Altered Expression	[28]
Endometrial carcinoma	DISXR5CY	moderate	Biomarker	[29]
Hypoglycemia	DISRCKR7	moderate	Altered Expression	[30]
Lipodystrophy	DIS3SGVD	moderate	Biomarker	[31]
Osteoarthritis	DIS05URM	moderate	Biomarker	[32]
Pancreatic cancer	DISJC981	moderate	Altered Expression	[29]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[33]
Coronary atherosclerosis	DISKNDYU	Limited	Genetic Variation	[34]
Coronary heart disease	DIS5OIP1	Limited	Genetic Variation	[34]
Hyperglycemia	DIS0BZB5	Limited	Biomarker	[35]
Inflammation	DISJUQ5T	Limited	Altered Expression	[36]
Myotonic dystrophy type 1	DISJC0OX	Limited	Biomarker	[37]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[38]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[39]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[40]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[41]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[42]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[43]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[44]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[45]
Marinol	DM70IK5	Approved	Marinol increases the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[46]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[47]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[41]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[41]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[41]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[48]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[49]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[50]
GW7604	DMCA4RM	Investigative	GW7604 increases the expression of CCHC-type zinc finger nucleic acid binding protein (CNBP).	[41]

References

• [1] Human lymphocyte antigen DR7 protects against proliferative retinopathy with type II diabetes mellitus.Arch Med Res. 2002 Mar-Apr;33(2):123-7. doi: 10.1016/s0188-4409(01)00378-2.
• [2] Circ-HuR suppresses HuR expression and gastric cancer progression by inhibiting CNBP transactivation.Mol Cancer. 2019 Nov 13;18(1):158. doi: 10.1186/s12943-019-1094-z.
• [3] Premutation allele pool in myotonic dystrophy type 2. Neurology. 2009 Feb 10;72(6):490-7. doi: 10.1212/01.wnl.0000333665.01888.33. Epub 2008 Nov 19.
• [4] U18666A, an activator of sterol regulatory element binding protein pathway, modulates presynaptic dopaminergic phenotype of SH-SY5Y neuroblastoma cells.Synapse. 2017 Sep;71(9). doi: 10.1002/syn.21980. Epub 2017 Jun 20.
• [5] Preliminary screening and analysis of metastasis-related lncRNA and co-expressed papillary thyroid carcinoma mRNA.Oncol Lett. 2018 Sep;16(3):3715-3725. doi: 10.3892/ol.2018.9080. Epub 2018 Jul 5.
• [6] -1,6-Fucosyltransferase (FUT8) inhibits hemoglobin production during differentiation of murine and K562 human erythroleukemia cells.J Biol Chem. 2013 Jun 7;288(23):16839-16847. doi: 10.1074/jbc.M113.459594. Epub 2013 Apr 22.
• [7] Autocrine platelet-derived growth factor-dependent gene expression in glioblastoma cells is mediated largely by activation of the transcription factor sterol regulatory element binding protein and is associated with altered genotype and patient survival in human brain tumors.Cancer Res. 2005 Jul 1;65(13):5523-34. doi: 10.1158/0008-5472.CAN-04-2582.
• [8] MiR-33a is a therapeutic target in SPG4-related hereditary spastic paraplegia human neurons.Clin Sci (Lond). 2019 Feb 22;133(4):583-595. doi: 10.1042/CS20180980. Print 2019 Feb 28.
• [9] Regulation of fatty acid synthase expression in breast cancer by sterol regulatory element binding protein-1c.Exp Cell Res. 2003 Jan 15;282(2):132-7. doi: 10.1016/s0014-4827(02)00023-x.
• [10] Adiponectin represses colon cancer cell proliferation via AdipoR1- and -R2-mediated AMPK activation.Mol Endocrinol. 2010 Jul;24(7):1441-52. doi: 10.1210/me.2009-0498. Epub 2010 May 5.
• [11] Expression of chicken ovalbumin upstream promoter-transcription factor II and liver X receptor as prognostic indicators for human colorectal cancer.Oncol Lett. 2017 Oct;14(4):4011-4020. doi: 10.3892/ol.2017.6659. Epub 2017 Jul 24.
• [12] Individual co-variation between viral RNA load and gene expression reveals novel host factors during early dengue virus infection of the Aedes aegypti midgut.PLoS Negl Trop Dis. 2017 Dec 19;11(12):e0006152. doi: 10.1371/journal.pntd.0006152. eCollection 2017 Dec.
• [13] The status of -3 PUFAs influence chronic unpredicted mild stress-induced metabolic side effects in rats through INSIG/SREBP pathway.Food Funct. 2019 Aug 1;10(8):4649-4660. doi: 10.1039/c9fo00076c. Epub 2019 Jul 11.
• [14] Inhibition of SREBP With Fatostatin Does Not Attenuate Early Diabetic Nephropathy in Male Mice.Endocrinology. 2018 Mar 1;159(3):1479-1495. doi: 10.1210/en.2018-00093.
• [15] Cellular nucleic acid binding protein suppresses tumor cell metastasis and induces tumor cell death by downregulating heterogeneous ribonucleoprotein K in fibrosarcoma cells.Biochim Biophys Acta. 2014 Jul;1840(7):2244-52. doi: 10.1016/j.bbagen.2014.02.025. Epub 2014 Mar 2.
• [16] Metabolic alterations and hepatitis C: From bench to bedside.World J Gastroenterol. 2016 Jan 28;22(4):1461-76. doi: 10.3748/wjg.v22.i4.1461.
• [17] Channeling of newly synthesized fatty acids to cholesterol esterification limits triglyceride synthesis in SND1-overexpressing hepatoma cells.Biochim Biophys Acta Mol Cell Biol Lipids. 2019 Feb;1864(2):137-146. doi: 10.1016/j.bbalip.2018.11.004. Epub 2018 Nov 16.
• [18] Anti-inflammatory effects of heat-killed Lactobacillus plantarum L-137 on cardiac and adipose tissue in rats with metabolic syndrome.Sci Rep. 2018 May 25;8(1):8156. doi: 10.1038/s41598-018-26588-x.
• [19] Sterol regulatory element-binding protein-1c mediates increase of postprandial stearic acid, a potential target for improving insulin resistance, in hyperlipidemia.Diabetes. 2013 Feb;62(2):561-71. doi: 10.2337/db12-0139. Epub 2012 Sep 10.
• [20] Hypolipidemic activity and mechanisms of the total phenylpropanoid glycosides from Ligustrum robustum (Roxb.) Blume by AMPK-SREBP-1c pathway in hamsters fed a high-fat diet.Phytother Res. 2018 Apr;32(4):715-722. doi: 10.1002/ptr.6023. Epub 2018 Feb 22.
• [21] Hypothyroidism unmasking proximal myotonic myopathy.Neuromuscul Disord. 2000 Mar;10(3):165-72. doi: 10.1016/s0960-8966(99)00097-8.
• [22] Oxidative Stress in HIV Infection and Alcohol Use: Role of Redox Signals in Modulation of Lipid Rafts and ATP-Binding Cassette Transporters.Antioxid Redox Signal. 2018 Feb 1;28(4):324-337. doi: 10.1089/ars.2016.6830.
• [23] Ursodeoxycholic acid ameliorates hepatic lipid metabolism in LO2 cells by regulating the AKT/mTOR/SREBP-1 signaling pathway.World J Gastroenterol. 2019 Mar 28;25(12):1492-1501. doi: 10.3748/wjg.v25.i12.1492.
• [24] Statin consumption as a risk factor for developing colorectal cancer: a retrospective case study.World J Surg Oncol. 2017 Dec 16;15(1):222. doi: 10.1186/s12957-017-1287-0.
• [25] Consumption of Ocimum sanctum L. and Citrus paradisi infusions modulates lipid metabolism and insulin resistance in obese rats.Food Funct. 2014 May;5(5):927-35. doi: 10.1039/c3fo60604j.
• [26] Deficiency of sterol regulatory element-binding protein-1c induces schizophrenia-like behavior in mice.Genes Brain Behav. 2019 Apr;18(4):e12540. doi: 10.1111/gbb.12540. Epub 2018 Dec 5.
• [27] Leptin reverses insulin resistance and diabetes mellitus in mice with congenital lipodystrophy.Nature. 1999 Sep 2;401(6748):73-6. doi: 10.1038/43448.
• [28] Sterol regulatory element-binding protein-1c knockdown protected INS-1E cells from lipotoxicity.Diabetes Obes Metab. 2010 Jan;12(1):35-46. doi: 10.1111/j.1463-1326.2009.01093.x. Epub 2009 Sep 16.
• [29] Fatostatin suppresses growth and enhances apoptosis by blocking SREBP-regulated metabolic pathways in endometrial carcinoma. Oncol Rep. 2018 Apr;39(4):1919-1929.
• [30] Hepatic Akt activation induces marked hypoglycemia, hepatomegaly, and hypertriglyceridemia with sterol regulatory element binding protein involvement.Diabetes. 2003 Dec;52(12):2905-13. doi: 10.2337/diabetes.52.12.2905.
• [31] Transgenic Mice Overexpressing SREBP-1a in Male ob/ob Mice Exhibit Lipodystrophy and Exacerbate Insulin Resistance.Endocrinology. 2018 Jun 1;159(6):2308-2323. doi: 10.1210/en.2017-03179.
• [32] Oleanolic Acid Inhibits Liver X Receptor Alpha and Pregnane X Receptor to Attenuate Ligand-Induced Lipogenesis.J Agric Food Chem. 2018 Oct 24;66(42):10964-10976. doi: 10.1021/acs.jafc.8b03372. Epub 2018 Oct 15.
• [33] Sterol Regulatory Element Binding Protein Regulates the Expression and Metabolic Functions of Wild-Type and Oncogenic IDH1.Mol Cell Biol. 2016 Aug 26;36(18):2384-95. doi: 10.1128/MCB.00163-16. Print 2016 Sep 15.
• [34] Associations of the SREBP-1c gene polymorphism with gender-specific changes in serum lipids induced by a high-carbohydrate diet in healthy Chinese youth.Appl Physiol Nutr Metab. 2011 Apr;36(2):226-32. doi: 10.1139/h11-005.
• [35] A new transgenic rat model of hepatic steatosis and the metabolic syndrome.Hypertension. 2005 May;45(5):1004-11. doi: 10.1161/01.HYP.0000161995.64192.2b. Epub 2005 Apr 4.
• [36] Sensing danger through a "finger".J Exp Med. 2018 Dec 3;215(12):2969-2971. doi: 10.1084/jem.20182034. Epub 2018 Nov 20.
• [37] Similar brain tau pathology in DM2/PROMM and DM1/Steinert disease.Neurology. 2005 Nov 22;65(10):1636-8. doi: 10.1212/01.wnl.0000184585.93864.4e.
• [38] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [39] Pharmacogenomic analysis of acute promyelocytic leukemia cells highlights CYP26 cytochrome metabolism in differential all-trans retinoic acid sensitivity. Blood. 2007 May 15;109(10):4450-60.
• [40] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [41] Gene expression profiles with activation of the estrogen receptor alpha-selective estrogen receptor modulator complex in breast cancer cells expressing wild-type estrogen receptor. Cancer Res. 2002 Aug 1;62(15):4419-26.
• [42] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [43] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [44] Proteomic analysis of liver cancer cells treated with suberonylanilide hydroxamic acid. Cancer Chemother Pharmacol. 2008 Apr;61(5):791-802.
• [45] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [46] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [47] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [48] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [49] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [50] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.