Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTIDM3P)

• DOT Name: Fanconi anemia group C protein (FANCC)
• Synonyms: Protein FACC
• Gene Name: FANCC
• Related Disease:
  Fanconi anemia complementation group A
  Fanconi anemia complementation group C
  Acute leukaemia
  Acute lymphocytic leukaemia
  Acute monocytic leukemia
  Acute myelogenous leukaemia
  Asthma
  Ataxia-telangiectasia
  Atrial fibrillation
  Autoimmune hepatitis
  Bloom syndrome
  Breast carcinoma
  Carcinoma
  Cardiomyopathy
  Cholangiocarcinoma
  Chromosomal disorder
  Colon cancer
  Colorectal carcinoma
  Deafness
  Dilated cardiomyopathy 1A
  Head-neck squamous cell carcinoma
  Hematologic disease
  Hepatocellular carcinoma
  Hydrocephalus
  Leukemia
  Lung adenocarcinoma
  Metabolic disorder
  Multiple sclerosis
  Myelodysplastic syndrome
  Neoplasm
  Nervous system inflammation
  Osteoporosis
  Pancreatic cancer
  Pancreatic tumour
  Pancytopenia
  Polyneuropathy
  Sleep disorder
  Trichohepatoenteric syndrome
  Tuberculosis
  Adenocarcinoma
  Hyperglycemia
  Metastatic malignant neoplasm
  Fanconi's anemia
  Hereditary neoplastic syndrome
  Arrhythmia
  Breast cancer
  Colorectal cancer
  Friedreich ataxia 1
  Hyperinsulinemia
  Malignant pancreatic neoplasm
  Ovarian cancer
  Stroke
• UniProt ID: FANCC_HUMAN
• PDB ID: 7KZP; 7KZQ; 7KZR; 7KZS; 7KZT; 7KZV
• Pfam ID: PF02106
• Sequence:
  MAQDSVDLSCDYQFWMQKLSVWDQASTLETQQDTCLHVAQFQEFLRKMYEALKEMDSNTV
  IERFPTIGQLLAKACWNPFILAYDESQKILIWCLCCLINKEPQNSGQSKLNSWIQGVLSH
  ILSALRFDKEVALFTQGLGYAPIDYYPGLLKNMVLSLASELRENHLNGFNTQRRMAPERV
  ASLSRVCVPLITLTDVDPLVEALLICHGREPQEILQPEFFEAVNEAILLKKISLPMSAVV
  CLWLRHLPSLEKAMLHLFEKLISSERNCLRRIECFIKDSSLPQAACHPAIFRVVDEMFRC
  ALLETDGALEIIATIQVFTQCFVEALEKASKQLRFALKTYFPYTSPSLAMVLLQDPQDIP
  RGHWLQTLKHISELLREAVEDQTHGSCGGPFESWFLFIHFGGWAEMVAEQLLMSAAEPPT
  ALLWLLAFYYGPRDGRQQRAQTMVQVKAVLGHLLAMSRSSSLSAQDLQTVAGQGTDTDLR
  APAQQLIRHLLLNFLLWAPGGHTIAWDVITLMAHTAEITHEIIGFLDQTLYRWNRLGIES
  PRSEKLARELLKELRTQV
• Function: DNA repair protein that may operate in a postreplication repair or a cell cycle checkpoint function. May be implicated in interstrand DNA cross-link repair and in the maintenance of normal chromosome stability. Upon IFNG induction, may facilitate STAT1 activation by recruiting STAT1 to IFNGR1.
• Tissue Specificity: Ubiquitous.
• KEGG Pathway: Fanconi anemia pathway (hsa03460)
• Reactome Pathway:
  TP53 Regulates Transcription of DNA Repair Genes (R-HSA-6796648)
  PKR-mediated signaling (R-HSA-9833482)
  Fanconi Anemia Pathway (R-HSA-6783310)

Molecular Interaction Atlas (MIA) of This DOT

52 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Fanconi anemia complementation group A	DIS8PZLI	Definitive	Biomarker	[1]
Fanconi anemia complementation group C	DISKMU3D	Definitive	Autosomal recessive	[2]
Acute leukaemia	DISDQFDI	Strong	Posttranslational Modification	[3]
Acute lymphocytic leukaemia	DISPX75S	Strong	Posttranslational Modification	[3]
Acute monocytic leukemia	DIS28NEL	Strong	Biomarker	[4]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[4]
Asthma	DISW9QNS	Strong	Genetic Variation	[5]
Ataxia-telangiectasia	DISP3EVR	Strong	Genetic Variation	[5]
Atrial fibrillation	DIS15W6U	Strong	Altered Expression	[6]
Autoimmune hepatitis	DISOX03Q	Strong	Biomarker	[7]
Bloom syndrome	DISKXQ7J	Strong	Genetic Variation	[8]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[1]
Carcinoma	DISH9F1N	Strong	Genetic Variation	[9]
Cardiomyopathy	DISUPZRG	Strong	Genetic Variation	[10]
Cholangiocarcinoma	DIS71F6X	Strong	Biomarker	[11]
Chromosomal disorder	DISM5BB5	Strong	Biomarker	[12]
Colon cancer	DISVC52G	Strong	Genetic Variation	[13]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[14]
Deafness	DISKCLH4	Strong	Biomarker	[15]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Genetic Variation	[16]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[17]
Hematologic disease	DIS9XD9A	Strong	Biomarker	[18]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[19]
Hydrocephalus	DISIZUF7	Strong	Genetic Variation	[20]
Leukemia	DISNAKFL	Strong	Biomarker	[4]
Lung adenocarcinoma	DISD51WR	Strong	Genetic Variation	[21]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[22]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[23]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[4]
Neoplasm	DISZKGEW	Strong	Biomarker	[24]
Nervous system inflammation	DISB3X5A	Strong	Genetic Variation	[23]
Osteoporosis	DISF2JE0	Strong	Biomarker	[25]
Pancreatic cancer	DISJC981	Strong	Genetic Variation	[26]
Pancreatic tumour	DIS3U0LK	Strong	Biomarker	[27]
Pancytopenia	DISVKEHV	Strong	Biomarker	[4]
Polyneuropathy	DISB9G3W	Strong	Genetic Variation	[10]
Sleep disorder	DIS3JP1U	Strong	Biomarker	[28]
Trichohepatoenteric syndrome	DISL3ODF	Strong	Genetic Variation	[29]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[30]
Adenocarcinoma	DIS3IHTY	moderate	Biomarker	[31]
Hyperglycemia	DIS0BZB5	moderate	Biomarker	[32]
Metastatic malignant neoplasm	DIS86UK6	moderate	Genetic Variation	[33]
Fanconi's anemia	DISGW6Q8	Supportive	Autosomal recessive	[34]
Hereditary neoplastic syndrome	DISGXLG5	Disputed	CausalMutation	[35]
Arrhythmia	DISFF2NI	Limited	Biomarker	[36]
Breast cancer	DIS7DPX1	Limited	Autosomal dominant	[37]
Colorectal cancer	DISNH7P9	Limited	Autosomal dominant	[37]
Friedreich ataxia 1	DIS285GE	Limited	Genetic Variation	[38]
Hyperinsulinemia	DISIDWT6	Limited	Biomarker	[32]
Malignant pancreatic neoplasm	DISH4FJX	Limited	Autosomal dominant	[37]
Ovarian cancer	DISZJHAP	Limited	Autosomal dominant	[37]
Stroke	DISX6UHX	Limited	Biomarker	[39]

This DOT Affected the Drug Response of 5 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Fanconi anemia group C protein (FANCC) affects the response to substance of Temozolomide.	[54]
DTI-015	DMXZRW0	Approved	Fanconi anemia group C protein (FANCC) affects the response to substance of DTI-015.	[54]
Melphalan	DMOLNHF	Approved	Fanconi anemia group C protein (FANCC) increases the response to substance of Melphalan.	[55]
Chlorambucil	DMRKE63	Approved	Fanconi anemia group C protein (FANCC) increases the response to substance of Chlorambucil.	[55]
Formaldehyde	DM7Q6M0	Investigative	Fanconi anemia group C protein (FANCC) increases the response to substance of Formaldehyde.	[56]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Fanconi anemia group C protein (FANCC).	[40]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Fanconi anemia group C protein (FANCC).	[41]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Fanconi anemia group C protein (FANCC).	[42]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Fanconi anemia group C protein (FANCC).	[43]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Fanconi anemia group C protein (FANCC).	[45]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Fanconi anemia group C protein (FANCC).	[46]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Fanconi anemia group C protein (FANCC).	[46]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Fanconi anemia group C protein (FANCC).	[47]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Fanconi anemia group C protein (FANCC).	[48]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Fanconi anemia group C protein (FANCC).	[49]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Fanconi anemia group C protein (FANCC).	[50]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Fanconi anemia group C protein (FANCC).	[51]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Fanconi anemia group C protein (FANCC).	[47]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Fanconi anemia group C protein (FANCC).	[43]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Fanconi anemia group C protein (FANCC).	[52]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Fanconi anemia group C protein (FANCC).	[53]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Fanconi anemia group C protein (FANCC).	[44]

References

• [1] Two truncating variants in FANCC and breast cancer risk.Sci Rep. 2019 Aug 29;9(1):12524. doi: 10.1038/s41598-019-48804-y.
• [2] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [3] Hypermethylation of the FANCC and FANCL promoter regions in sporadic acute leukaemia.Cell Oncol. 2008;30(4):299-306. doi: 10.3233/clo-2008-0426.
• [4] Discussing and managing hematologic germ line variants.Blood. 2016 Nov 24;128(21):2497-2503. doi: 10.1182/blood-2016-06-716704.
• [5] Association of FANCC polymorphisms with FEV1 decline in aspirin exacerbated respiratory disease.Mol Biol Rep. 2012 Mar;39(3):2385-94. doi: 10.1007/s11033-011-0989-6. Epub 2011 Jun 14.
• [6] Genetic variants associated with risk of atrial fibrillation regulate expression of PITX2, CAV1, MYOZ1, C9orf3 and FANCC.J Mol Cell Cardiol. 2015 Aug;85:207-14. doi: 10.1016/j.yjmcc.2015.06.005. Epub 2015 Jun 11.
• [7] (18)F-FAC PET Selectively Images Liver-Infiltrating CD4 and CD8 T Cells in a Mouse Model of Autoimmune Hepatitis.J Nucl Med. 2018 Oct;59(10):1616-1623. doi: 10.2967/jnumed.118.210328. Epub 2018 Apr 26.
• [8] Exome sequencing identifies rare deleterious mutations in DNA repair genes FANCC and BLM as potential breast cancer susceptibility alleles.PLoS Genet. 2012 Sep;8(9):e1002894. doi: 10.1371/journal.pgen.1002894. Epub 2012 Sep 27.
• [9] Disruption of the FA/BRCA pathway in bladder cancer.Cytogenet Genome Res. 2007;118(2-4):166-76. doi: 10.1159/000108297.
• [10] Amyloid and nonfibrillar deposits in mice transgenic for wild-type human transthyretin: a possible model for senile systemic amyloidosis.Lab Invest. 2001 Mar;81(3):385-96. doi: 10.1038/labinvest.3780246.
• [11] Tamoxifen (TMX)/Fas induced growth inhibition of human cholangiocarcinoma (HCC) by gamma interferon (IFN-gamma).Ann Surg. 2002 Jun;235(6):872-8. doi: 10.1097/00000658-200206000-00016.
• [12] Correction of the spontaneous and DEB-induced chromosomal aberrations in Fanconi anemia cells of the FA(C) complementation group by the FACC gene.Cytogenet Cell Genet. 1996;72(2-3):194-6. doi: 10.1159/000134187.
• [13] Prevalence of breast and colorectal cancer in Ashkenazi Jewish carriers of Fanconi anemia and Bloom syndrome.Isr Med Assoc J. 2007 Dec;9(12):847-50.
• [14] The Fanconi anemia DNA damage repair pathway in the spotlight for germline predisposition to colorectal cancer.Eur J Hum Genet. 2016 Oct;24(10):1501-5. doi: 10.1038/ejhg.2016.44. Epub 2016 May 11.
• [15] Molecular pathogenesis of Fanconi anemia: recent progress.Blood. 2006 Jun 1;107(11):4223-33. doi: 10.1182/blood-2005-10-4240. Epub 2006 Feb 21.
• [16] Echocardiographic assessment of right ventricular function in routine practice: Which parameters are useful to predict one-year outcome in advanced heart failure patients with dilated cardiomyopathy?.J Cardiol. 2017 Oct;70(4):316-322. doi: 10.1016/j.jjcc.2017.02.007. Epub 2017 Mar 21.
• [17] Association of FANCC and PTCH1 with the development of early dysplastic lesions of the head and neck.Ann Surg Oncol. 2012 Jul;19 Suppl 3:S528-38. doi: 10.1245/s10434-011-1991-x. Epub 2011 Aug 23.
• [18] Prenatal diagnosis of Fanconi anemia (Group C) subsequent to abnormal sonographic findings.Prenat Diagn. 2005 Jan;25(1):20-2. doi: 10.1002/pd.1055.
• [19] Anticancer potential of ZnO nanoparticle-ferulic acid conjugate on Huh-7 and HepG2 cells and diethyl nitrosamine induced hepatocellular cancer on Wistar albino rat.Nanomedicine. 2018 Feb;14(2):415-428. doi: 10.1016/j.nano.2017.11.003. Epub 2017 Nov 21.
• [20] VACTERL with hydrocephalus in twins due to Fanconi anemia (FA): mutation in the FAC gene.Am J Med Genet. 1997 Jan 10;68(1):86-90.
• [21] Fanconi anemia genes in lung adenocarcinoma- a pathway-wide study on cancer susceptibility.J Biomed Sci. 2016 Feb 3;23:23. doi: 10.1186/s12929-016-0240-9.
• [22] Fanconi Anemia complementation group C protein in metabolic disorders.Aging (Albany NY). 2018 Jun 21;10(6):1506-1522. doi: 10.18632/aging.101487.
• [23] (18)F-FAC PET Visualizes Brain-Infiltrating Leukocytes in a Mouse Model of Multiple Sclerosis.J Nucl Med. 2020 May;61(5):757-763. doi: 10.2967/jnumed.119.229351. Epub 2019 Oct 25.
• [24] Deoxycytidine kinase augments ATM-Mediated DNA repair and contributes to radiation resistance.PLoS One. 2014 Aug 7;9(8):e104125. doi: 10.1371/journal.pone.0104125. eCollection 2014.
• [25] Novel and rapid osteoporosis model established in zebrafish using high iron stress.Biochem Biophys Res Commun. 2018 Feb 5;496(2):654-660. doi: 10.1016/j.bbrc.2017.12.172. Epub 2018 Jan 3.
• [26] Germ line Fanconi anemia complementation group C mutations and pancreatic cancer.Cancer Res. 2005 Jan 15;65(2):383-6.
• [27] Fanconi anemia pathway-deficient tumor cells are hypersensitive to inhibition of ataxia telangiectasia mutated.J Clin Invest. 2007 May;117(5):1440-9. doi: 10.1172/JCI31245. Epub 2007 Apr 12.
• [28] Sleep disturbances negatively affect balance and gait function in post-stroke patients.NeuroRehabilitation. 2018;43(2):211-218. doi: 10.3233/NRE-172351.
• [29] Phenotypic consequences of mutations in the Fanconi anemia FAC gene: an International Fanconi Anemia Registry study.Blood. 1997 Jul 1;90(1):105-10.
• [30] Micro-PET imaging of [18F]fluoroacetate combined with [18F]FDG to differentiate chronic Mycobacterium tuberculosis infection from an acute bacterial infection in a mouse model: a preliminary study.Nucl Med Commun. 2019 Jun;40(6):639-644. doi: 10.1097/MNM.0000000000001017.
• [31] Targeted disruption of FANCC and FANCG in human cancer provides a preclinical model for specific therapeutic options.Gastroenterology. 2006 Jun;130(7):2145-54. doi: 10.1053/j.gastro.2006.03.016.
• [32] Fanconi anemia links reactive oxygen species to insulin resistance and obesity. Antioxid Redox Signal. 2012 Oct 15;17(8):1083-98. doi: 10.1089/ars.2011.4417. Epub 2012 Jun 25.
• [33] Genetic polymorphisms and response to 5-fluorouracil, doxorubicin and cyclophosphamide chemotherapy in breast cancer patients.Oncotarget. 2016 Oct 11;7(41):66790-66808. doi: 10.18632/oncotarget.11053.
• [34] Fanconi Anemia. 2002 Feb 14 [updated 2021 Jun 3]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
• [35] Treatment Outcomes and Tumor Loss of Heterozygosity in Germline DNA Repair-deficient Prostate Cancer.Eur Urol. 2017 Jul;72(1):34-42. doi: 10.1016/j.eururo.2017.02.023. Epub 2017 Mar 1.
• [36] Right ventricular and pulmonary vascular function indices for risk stratification of patients with pulmonary regurgitation.Congenit Heart Dis. 2019 Jul;14(4):657-664. doi: 10.1111/chd.12768. Epub 2019 Apr 8.
• [37] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [38] Correct mRNA processing at a mutant TT splice donor in FANCC ameliorates the clinical phenotype in patients and is enhanced by delivery of suppressor U1 snRNAs.Am J Hum Genet. 2010 Oct 8;87(4):480-93. doi: 10.1016/j.ajhg.2010.08.016.
• [39] Interleukin-6 is independently associated with right ventricular function in pulmonary arterial hypertension.J Heart Lung Transplant. 2018 Mar;37(3):376-384. doi: 10.1016/j.healun.2017.08.011. Epub 2017 Sep 1.
• [40] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [41] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [42] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [43] Changes in gene expressions elicited by physiological concentrations of genistein on human endometrial cancer cells. Mol Carcinog. 2006 Oct;45(10):752-63.
• [44] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [45] Role of NADPH oxidase in arsenic-induced reactive oxygen species formation and cytotoxicity in myeloid leukemia cells. Proc Natl Acad Sci U S A. 2004 Mar 30;101(13):4578-83.
• [46] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [47] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [48] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [49] Transcriptional profiling of MCF7 breast cancer cells in response to 5-Fluorouracil: relationship with cell cycle changes and apoptosis, and identification of novel targets of p53. Int J Cancer. 2006 Sep 1;119(5):1164-75.
• [50] Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
• [51] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [52] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [53] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [54] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.
• [55] In vivo therapeutic responses contingent on Fanconi anemia/BRCA2 status of the tumor. Clin Cancer Res. 2005 Oct 15;11(20):7508-15. doi: 10.1158/1078-0432.CCR-05-1048.
• [56] Cells deficient in the FANC/BRCA pathway are hypersensitive to plasma levels of formaldehyde. Cancer Res. 2007 Dec 1;67(23):11117-22. doi: 10.1158/0008-5472.CAN-07-3028.