Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT22C116)

DOT Name	Coiled-coil alpha-helical rod protein 1 (CCHCR1)
Synonyms	Alpha-helical coiled-coil rod protein; Putative gene 8 protein; Pg8
Gene Name	CCHCR1
Related Disease	Hepatitis B virus infection ( ) Type-1 diabetes ( ) Alzheimer disease ( ) Atherosclerosis ( ) Behcet disease ( ) Carcinoma of esophagus ( ) Cardiovascular disease ( ) Coronary heart disease ( ) Depression ( ) Esophageal squamous cell carcinoma ( ) Essential hypertension ( ) Factor IX deficiency ( ) Fatty liver disease ( ) Graves disease ( ) Hypertension, pregnancy-induced ( ) Hypoglycemia ( ) Neoplasm ( ) Nephropathy ( ) Non-alcoholic fatty liver disease ( ) Non-insulin dependent diabetes ( ) Obesity ( ) Obstructive sleep apnea ( ) OPTN-related open angle glaucoma ( ) Peripheral arterial disease ( ) Plasma cell myeloma ( ) Prostate carcinoma ( ) Prostate neoplasm ( ) Rheumatoid arthritis ( ) Squamous cell carcinoma ( ) Vitiligo ( ) Asthma ( ) Stroke ( ) Type-1/2 diabetes ( ) Coronary atherosclerosis ( ) Diabetic kidney disease ( ) Adult glioblastoma ( ) Chronic kidney disease ( ) Classic Hodgkin lymphoma ( ) Glioblastoma multiforme ( ) Huntington disease ( ) Orthostatic hypotension ( ) Prostate cancer ( ) Psoriasis ( ) Schizophrenia ( ) Ulcerative colitis ( )
UniProt ID	CCHCR_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF07111
Sequence	MFPPSGSTGLIPPSHFQARPLSTLPRMAPTWLSDIPLVQPPGHQDVSERRLDTQRPQVTM WERDVSSDRQEPGRRGRSWGLEGSQALSQQAEVIVRQLQELRRLEEEVRLLRETSLQQKM RLEAQAMELEALARAEKAGRAEAEGLRAALAGAEVVRKNLEEGSQRELEEVQRLHQEQLS SLTQAHEEALSSLTSKAEGLEKSLSSLETRRAGEAKELAEAQREAELLRKQLSKTQEDLE AQVTLVENLRKYVGEQVPSEVHSQTWELERQKLLETMQHLQEDRDSLHATAELLQVRVQS LTHILALQEEELTRKVQPSDSLEPEFTRKCQSLLNRWREKVFALMVQLKAQELEHSDSVK QLKGQVASLQEKVTSQSQEQAILQRSLQDKAAEVEVERMGAKGLQLELSRAQEARRRWQQ QTASAEEQLRLVVNAVSSSQIWLETTMAKVEGAAAQLPSLNNRLSYAVRKVHTIRGLIAR KLALAQLRQESCPLPPPVTDVSLELQQLREERNRLDAELQLSARLIQQEVGRAREQGEAE RQQLSKVAQQLEQELQQTQESLASLGLQLEVARQGQQESTEEAASLRQELTQQQELYGQA LQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSLRQIQRRAAQEKERSQELRRLQEE ARKEEGQRLARRLQELERDKNLMLATLQQEGLLSRYKQQRLLTVLPSLLDKKKSVVSSPR PPECSASAPVAAAVPTRESIKGSLSVLLDDLQDLSEAISKEEAVCQGDNLDRCSSSNPQM SS
Function	May be a regulator of keratinocyte proliferation or differentiation.
Tissue Specificity	Found in all tissues tested, abundantly expressed in heart, liver, skeletal muscle, kidney and pancreas, and to a lesser extent in lung and placenta. Overexpressed in keratinocytes of psoriatic lesions.

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Hepatitis B virus infection	DISLQ2XY	Definitive	Biomarker	[1]
Type-1 diabetes	DIS7HLUB	Definitive	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[3]
Atherosclerosis	DISMN9J3	Strong	Altered Expression	[4]
Behcet disease	DISSYMBS	Strong	Genetic Variation	[5]
Carcinoma of esophagus	DISS6G4D	Strong	Genetic Variation	[6]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[7]
Coronary heart disease	DIS5OIP1	Strong	Biomarker	[8]
Depression	DIS3XJ69	Strong	Biomarker	[9]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[10]
Essential hypertension	DIS7WI98	Strong	Biomarker	[11]
Factor IX deficiency	DISHN9SC	Strong	Altered Expression	[12]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[13]
Graves disease	DISU4KOQ	Strong	Genetic Variation	[14]
Hypertension, pregnancy-induced	DISHNU25	Strong	Altered Expression	[15]
Hypoglycemia	DISRCKR7	Strong	Genetic Variation	[16]
Neoplasm	DISZKGEW	Strong	Altered Expression	[17]
Nephropathy	DISXWP4P	Strong	Genetic Variation	[18]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[19]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[20]
Obesity	DIS47Y1K	Strong	Genetic Variation	[21]
Obstructive sleep apnea	DIS0SVD1	Strong	Genetic Variation	[22]
OPTN-related open angle glaucoma	DISDR98A	Strong	Biomarker	[23]
Peripheral arterial disease	DIS78WFB	Strong	Biomarker	[24]
Plasma cell myeloma	DIS0DFZ0	Strong	Genetic Variation	[25]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[26]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[27]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[28]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[17]
Vitiligo	DISR05SL	Strong	Genetic Variation	[29]
Asthma	DISW9QNS	moderate	Genetic Variation	[30]
Stroke	DISX6UHX	moderate	Biomarker	[31]
Type-1/2 diabetes	DISIUHAP	moderate	Biomarker	[32]
Coronary atherosclerosis	DISKNDYU	Disputed	Biomarker	[8]
Diabetic kidney disease	DISJMWEY	Disputed	Genetic Variation	[18]
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[33]
Chronic kidney disease	DISW82R7	Limited	Biomarker	[34]
Classic Hodgkin lymphoma	DISV1LU6	Limited	Biomarker	[35]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[33]
Huntington disease	DISQPLA4	Limited	Biomarker	[35]
Orthostatic hypotension	DISBKQGT	Limited	Biomarker	[36]
Prostate cancer	DISF190Y	Limited	Genetic Variation	[27]
Psoriasis	DIS59VMN	Limited	Genetic Variation	[37]
Schizophrenia	DISSRV2N	Limited	Genetic Variation	[38]
Ulcerative colitis	DIS8K27O	Limited	Genetic Variation	[39]
------------------------------------------------------------------------------------


⏷ Show the Full List of 45 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Methamphetamine	DMPM4SK	Approved	Coiled-coil alpha-helical rod protein 1 (CCHCR1) affects the response to substance of Methamphetamine.	[52]
------------------------------------------------------------------------------------

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Coiled-coil alpha-helical rod protein 1 (CCHCR1).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Coiled-coil alpha-helical rod protein 1 (CCHCR1).	[41]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Coiled-coil alpha-helical rod protein 1 (CCHCR1).	[42]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Coiled-coil alpha-helical rod protein 1 (CCHCR1).	[43]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Coiled-coil alpha-helical rod protein 1 (CCHCR1).	[45]
Selenium	DM25CGV	Approved	Selenium increases the expression of Coiled-coil alpha-helical rod protein 1 (CCHCR1).	[46]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Coiled-coil alpha-helical rod protein 1 (CCHCR1).	[47]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Coiled-coil alpha-helical rod protein 1 (CCHCR1).	[48]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Coiled-coil alpha-helical rod protein 1 (CCHCR1).	[49]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Coiled-coil alpha-helical rod protein 1 (CCHCR1).	[46]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Coiled-coil alpha-helical rod protein 1 (CCHCR1).	[50]
------------------------------------------------------------------------------------


⏷ Show the Full List of 11 Drug(s)

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Coiled-coil alpha-helical rod protein 1 (CCHCR1).	[44]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Coiled-coil alpha-helical rod protein 1 (CCHCR1).	[51]
------------------------------------------------------------------------------------

References

1	A Pre-Clinical Safety Evaluation of SBP (HBsAg-Binding Protein) Adjuvant for Hepatitis B Vaccine.PLoS One. 2017 Jan 19;12(1):e0170313. doi: 10.1371/journal.pone.0170313. eCollection 2017.
2	Blood pressure, antihypertensive medication use, and risk of erectile dysfunction in men with type I diabetes.J Hypertens. 2019 May;37(5):1070-1076. doi: 10.1097/HJH.0000000000001988.
3	Antihypertensive medications and risk for incident dementia and Alzheimer's disease: a meta-analysis of individual participant data from prospective cohort studies.Lancet Neurol. 2020 Jan;19(1):61-70. doi: 10.1016/S1474-4422(19)30393-X. Epub 2019 Nov 6.
4	LIPID ACCUMULATION PRODUCT, VISCERAL ADIPOSITY INDEX, AND CHINESE VISCERAL ADIPOSITY INDEX AS MARKERS OF CARDIOMETABOLIC RISK IN ADULT GROWTH HORMONE DEFICIENCY PATIENTS: A CROSS-SECTIONAL STUDY.Endocr Pract. 2018 Jan;24(1):33-39. doi: 10.4158/EP-2017-0007. Epub 2017 Nov 16.
5	Identification of a susceptibility locus in STAT4 for Behet's disease in Han Chinese in a genome-wide association study.Arthritis Rheum. 2012 Dec;64(12):4104-13. doi: 10.1002/art.37708.
6	DNA aneuploidy assessment of the effectiveness of hyperthermo-chemo-radiotherapy for esophageal carcinoma.Cancer. 1989 May 15;63(10):1951-5. doi: 10.1002/1097-0142(19890515)63:10<1951::aid-cncr2820631014>3.0.co;2-4.
7	Associations of blood pressure categories defined by 2017 ACC/AHA guidelines with mortality in China: Pooled results from three prospective cohorts.Eur J Prev Cardiol. 2020 Mar;27(4):345-354. doi: 10.1177/2047487319862066. Epub 2019 Jul 9.
8	SBP above 180mmHg at moderate exercise workload increases coronary heart disease risk in healthy men during 28-year follow-up.J Hypertens. 2019 May;37(5):949-955. doi: 10.1097/HJH.0000000000001959.
9	Relationships between depression and anxiety symptoms scores and blood pressure in young adults.J Hypertens. 2017 Oct;35(10):1983-1991. doi: 10.1097/HJH.0000000000001410.
10	Exome-wide analyses identify low-frequency variant in CYP26B1 and additional coding variants associated with esophageal squamous cell carcinoma. Nat Genet. 2018 Mar;50(3):338-343. doi: 10.1038/s41588-018-0045-8. Epub 2018 Jan 29.
11	Effects of sodium nitrite on renal function and blood pressure in hypertensive vs. healthy study participants: a randomized, placebo-controlled, crossover study.J Hypertens. 2018 Mar;36(3):666-679. doi: 10.1097/HJH.0000000000001598.
12	Gene therapy for hemophilia B with liver-specific element mediated by Rep-RBE site-specific integration system.J Cardiovasc Pharmacol. 2015 Feb;65(2):153-9. doi: 10.1097/FJC.0000000000000172.
13	Atherogenic index of plasma is a novel and strong predictor associated with fatty liver: a cross-sectional study in the Chinese Han population.Lipids Health Dis. 2019 Sep 12;18(1):170. doi: 10.1186/s12944-019-1112-6.
14	Identification of independent risk loci for Graves' disease within the MHC in the Japanese population.J Hum Genet. 2011 Nov;56(11):772-8. doi: 10.1038/jhg.2011.99. Epub 2011 Sep 8.
15	Feature of trajectory of blood pressure among pregnant women with gestational hypertension.J Hypertens. 2020 Jan;38(1):127-132. doi: 10.1097/HJH.0000000000002197.
16	Comparison of costs and outcomes of dapagliflozin with other glucose-lowering therapy classes added to metformin using a short-term cost-effectiveness model in the US setting.J Med Econ. 2018 May;21(5):497-509. doi: 10.1080/13696998.2018.1434182. Epub 2018 Mar 1.
17	CCHCR1 is up-regulated in skin cancer and associated with EGFR expression.PLoS One. 2009 Jun 24;4(6):e6030. doi: 10.1371/journal.pone.0006030.
18	Prognostic value of visit-to-visit systolic blood pressure variability related to diabetic kidney disease among patients with type 2 diabetes.J Hypertens. 2019 Jul;37(7):1411-1418. doi: 10.1097/HJH.0000000000002038.
19	The impact of the sleep duration on NAFLD score in Korean middle-aged adults: a community-based cohort study.Sleep Med. 2019 May;57:144-150. doi: 10.1016/j.sleep.2019.02.012. Epub 2019 Mar 2.
20	Safety and efficacy of ertugliflozin in Asian patients with type 2 diabetes mellitus inadequately controlled with metformin monotherapy: VERTIS Asia.Diabetes Obes Metab. 2019 Jun;21(6):1474-1482. doi: 10.1111/dom.13681. Epub 2019 Apr 5.
21	Hypertension in aortic stenosis: relationship with revealed symptoms and functional measures on treadmill exercise.J Hypertens. 2019 Nov;37(11):2209-2215. doi: 10.1097/HJH.0000000000002149.
22	Renal artery denervation for treatment of patients with self-reported obstructive sleep apnea and resistant hypertension: results from the Global SYMPLICITY Registry.J Hypertens. 2017 Jan;35(1):148-153. doi: 10.1097/HJH.0000000000001142.
23	Inter-relationship between ocular perfusion pressure, blood pressure, intraocular pressure profiles and primary open-angle glaucoma: the Singapore Epidemiology of Eye Diseases study.Br J Ophthalmol. 2018 Oct;102(10):1402-1406. doi: 10.1136/bjophthalmol-2017-311359. Epub 2018 Jan 13.
24	Cohort Study Examining the Association Between Blood Pressure and Cardiovascular Events in Patients With Peripheral Artery Disease.J Am Heart Assoc. 2019 Mar 19;8(6):e010748. doi: 10.1161/JAHA.118.010748.
25	Genome-wide association study identifies multiple susceptibility loci for multiple myeloma.Nat Commun. 2016 Jul 1;7:12050. doi: 10.1038/ncomms12050.
26	Association analyses of more than 140,000 men identify 63 new prostate cancer susceptibility loci.Nat Genet. 2018 Jul;50(7):928-936. doi: 10.1038/s41588-018-0142-8. Epub 2018 Jun 11.
27	Seven prostate cancer susceptibility loci identified by a multi-stage genome-wide association study.Nat Genet. 2011 Jul 10;43(8):785-91. doi: 10.1038/ng.882.
28	REL, encoding a member of the NF-kappaB family of transcription factors, is a newly defined risk locus for rheumatoid arthritis.Nat Genet. 2009 Jul;41(7):820-3. doi: 10.1038/ng.395. Epub 2009 Jun 7.
29	Genome-wide association study for vitiligo identifies susceptibility loci at 6q27 and the MHC.Nat Genet. 2010 Jul;42(7):614-8. doi: 10.1038/ng.603. Epub 2010 Jun 6.
30	Metabolites downstream of predicted loss-of-function variants inform relationship to disease.Mol Genet Metab. 2019 Dec;128(4):476-482. doi: 10.1016/j.ymgme.2019.10.002. Epub 2019 Oct 17.
31	Inter-arm difference of systolic blood pressure measured by automated double-cuff device is associated with arterial stiffness in patients with hypertension.Blood Press Monit. 2020 Feb;25(1):26-33. doi: 10.1097/MBP.0000000000000416.
32	Chronic kidney disease progression in patients with resistant hypertension subject to 2 therapeutic strategies: Intensification with loop diuretics vs aldosterone antagonists.Nefrologia (Engl Ed). 2020 Jan-Feb;40(1):65-73. doi: 10.1016/j.nefro.2019.04.012. Epub 2019 Aug 23.
33	DNA Repair Capacity in Multiple Pathways Predicts Chemoresistance in Glioblastoma Multiforme.Cancer Res. 2017 Jan 1;77(1):198-206. doi: 10.1158/0008-5472.CAN-16-1151. Epub 2016 Oct 28.
34	Difference in SBP between arms is a predictor of chronic kidney disease development in the general Korean population.J Hypertens. 2019 Apr;37(4):790-794. doi: 10.1097/HJH.0000000000001931.
35	Forecast post-dialysis blood pressure in hemodialysis patients with intradialytic hypertension.Clin Exp Hypertens. 2019;41(6):571-576. doi: 10.1080/10641963.2018.1523916. Epub 2018 Oct 16.
36	Association of Orthostatic Hypotension Timing With Clinical Events in Adults With Diabetes and Hypertension: Results From the ACCORD Trial.Am J Hypertens. 2019 Jun 11;32(7):684-694. doi: 10.1093/ajh/hpz015.
37	Genome-wide association study of psoriasis in an Egyptian population.Exp Dermatol. 2019 May;28(5):623-627. doi: 10.1111/exd.13926.
38	Prediction of Violence, Suicide Behaviors and Suicide Ideation in a Sample of Institutionalized Offenders With Schizophrenia and Other Psychosis.Front Psychol. 2018 Aug 7;9:1385. doi: 10.3389/fpsyg.2018.01385. eCollection 2018.
39	A genome-wide association study identifies three new susceptibility loci for ulcerative colitis in the Japanese population.Nat Genet. 2009 Dec;41(12):1325-9. doi: 10.1038/ng.482. Epub 2009 Nov 15.
40	A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
41	Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
42	Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
43	17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
44	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
45	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
46	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
47	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
48	Effects of acute ethanol treatment on NCCIT cells and NCCIT cell-derived embryoid bodies (EBs). Toxicol In Vitro. 2010 Sep;24(6):1696-704. doi: 10.1016/j.tiv.2010.05.017. Epub 2010 May 26.
49	Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
50	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
51	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
52	Genome-wide association for methamphetamine dependence: convergent results from 2 samples. Arch Gen Psychiatry. 2008 Mar;65(3):345-55. doi: 10.1001/archpsyc.65.3.345.