Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2HDTL8)

• DOT Name: Adiponectin receptor protein 2 (ADIPOR2)
• Synonyms: Progestin and adipoQ receptor family member 2; Progestin and adipoQ receptor family member II
• Gene Name: ADIPOR2
• Related Disease:
  Advanced cancer
  Gastric neoplasm
  Liver cirrhosis
  Barrett esophagus
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cerebral infarction
  Chronic renal failure
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Congestive heart failure
  Coronary atherosclerosis
  Cystic fibrosis
  End-stage renal disease
  Fatty liver disease
  Glioblastoma multiforme
  Hyperinsulinemia
  Myocardial infarction
  Neoplasm
  Non-small-cell lung cancer
  Osteoarthritis
  Ovarian neoplasm
  Prostate neoplasm
  Rheumatoid arthritis
  Age-related macular degeneration
  Cardiovascular disease
  Chronic obstructive pulmonary disease
  Colorectal neoplasm
  Diabetic kidney disease
  Female infertility
  Gastrointestinal stromal tumour
  High blood pressure
  Polycystic ovarian syndrome
  Prostate cancer
  Prostate carcinoma
  Hyperglycemia
  Non-alcoholic fatty liver disease
  Adenocarcinoma
  Arteriosclerosis
  Atherosclerosis
  Clear cell renal carcinoma
  Coronary heart disease
  Ductal breast carcinoma in situ
  Fetal growth restriction
  Renal cell carcinoma
  Type-1 diabetes
• UniProt ID: PAQR2_HUMAN
• PDB ID: 5LWY; 5LX9; 5LXA; 6KS1; 6YX9; 6YXD; 6YXF; 6YXG
• Pfam ID: PF03006
• Sequence:
  MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSE
  EHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDF
  LLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQE
  KVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFY
  CNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE
  GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAF
  VHFHGVSNLQEFRFMIGGGCSEEDAL
• Function: Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism. Required for normal body fat and glucose homeostasis. ADIPOQ-binding activates a signaling cascade that leads to increased PPARA activity, and ultimately to increased fatty acid oxidation and glucose uptake. Has intermediate affinity for globular and full-length adiponectin. Required for normal revascularization after chronic ischemia caused by severing of blood vessels.
• Tissue Specificity: Ubiquitous . Highly expressed in skeletal muscle, liver and placenta . Weakly expressed in brain, heart, colon, spleen, kidney, thymus, small intestine, peripheral blood leukocytes and lung .
• KEGG Pathway:
  AMPK sig.ling pathway (hsa04152)
  Longevity regulating pathway (hsa04211)
  Adipocytokine sig.ling pathway (hsa04920)
  Non-alcoholic fatty liver disease (hsa04932)
  Alcoholic liver disease (hsa04936)
• Reactome Pathway: AMPK inhibits chREBP transcriptional activation activity (R-HSA-163680)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Definitive	Genetic Variation	[1]
Gastric neoplasm	DISOKN4Y	Definitive	Biomarker	[2]
Liver cirrhosis	DIS4G1GX	Definitive	Genetic Variation	[3]
Barrett esophagus	DIS416Y7	Strong	Biomarker	[4]
Breast cancer	DIS7DPX1	Strong	Biomarker	[5]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[6]
Cerebral infarction	DISR1WNP	Strong	Genetic Variation	[7]
Chronic renal failure	DISGG7K6	Strong	Biomarker	[8]
Colon cancer	DISVC52G	Strong	Biomarker	[9]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[10]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[11]
Coronary atherosclerosis	DISKNDYU	Strong	Altered Expression	[12]
Cystic fibrosis	DIS2OK1Q	Strong	Genetic Variation	[13]
End-stage renal disease	DISXA7GG	Strong	Biomarker	[8]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[14]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[15]
Hyperinsulinemia	DISIDWT6	Strong	Altered Expression	[16]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[17]
Neoplasm	DISZKGEW	Strong	Biomarker	[18]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[19]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[20]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[21]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[22]
Rheumatoid arthritis	DISTSB4J	Strong	Altered Expression	[20]
Age-related macular degeneration	DIS0XS2C	moderate	Biomarker	[23]
Cardiovascular disease	DIS2IQDX	moderate	Genetic Variation	[24]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Altered Expression	[25]
Colorectal neoplasm	DISR1UCN	moderate	Altered Expression	[26]
Diabetic kidney disease	DISJMWEY	moderate	Altered Expression	[27]
Female infertility	DIS9GNYZ	moderate	Biomarker	[28]
Gastrointestinal stromal tumour	DIS6TJYS	moderate	Altered Expression	[26]
High blood pressure	DISY2OHH	moderate	Biomarker	[29]
Polycystic ovarian syndrome	DISZ2BNG	moderate	Altered Expression	[30]
Prostate cancer	DISF190Y	moderate	Genetic Variation	[31]
Prostate carcinoma	DISMJPLE	moderate	Genetic Variation	[31]
Hyperglycemia	DIS0BZB5	Disputed	Altered Expression	[14]
Non-alcoholic fatty liver disease	DISDG1NL	Disputed	Biomarker	[32]
Adenocarcinoma	DIS3IHTY	Limited	Altered Expression	[33]
Arteriosclerosis	DISK5QGC	Limited	Biomarker	[34]
Atherosclerosis	DISMN9J3	Limited	Biomarker	[34]
Clear cell renal carcinoma	DISBXRFJ	Limited	Biomarker	[35]
Coronary heart disease	DIS5OIP1	Limited	Altered Expression	[36]
Ductal breast carcinoma in situ	DISLCJY7	Limited	Biomarker	[37]
Fetal growth restriction	DIS5WEJ5	Limited	Therapeutic	[38]
Renal cell carcinoma	DISQZ2X8	Limited	Biomarker	[35]
Type-1 diabetes	DIS7HLUB	Limited	Altered Expression	[39]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Phenytoin	DMNOKBV	Approved	Adiponectin receptor protein 2 (ADIPOR2) increases the Hypersensitivity ADR of Phenytoin.	[54]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Adiponectin receptor protein 2 (ADIPOR2).	[40]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Adiponectin receptor protein 2 (ADIPOR2).	[41]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Adiponectin receptor protein 2 (ADIPOR2).	[42]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Adiponectin receptor protein 2 (ADIPOR2).	[44]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Adiponectin receptor protein 2 (ADIPOR2).	[45]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Adiponectin receptor protein 2 (ADIPOR2).	[46]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Adiponectin receptor protein 2 (ADIPOR2).	[47]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Adiponectin receptor protein 2 (ADIPOR2).	[48]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Adiponectin receptor protein 2 (ADIPOR2).	[50]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Adiponectin receptor protein 2 (ADIPOR2).	[52]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Adiponectin receptor protein 2 (ADIPOR2).	[53]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Adiponectin receptor protein 2 (ADIPOR2).	[43]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Adiponectin receptor protein 2 (ADIPOR2).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Adiponectin receptor protein 2 (ADIPOR2).	[51]

References

• [1] Genetic analysis of ADIPOQ variants and gastric cancer risk: a hospital-based case-control study in China.Med Oncol. 2013;30(3):658. doi: 10.1007/s12032-013-0658-9. Epub 2013 Jul 25.
• [2] Adiponectin inhibits the growth and peritoneal metastasis of gastric cancer through its specific membrane receptors AdipoR1 and AdipoR2.Cancer Sci. 2007 Jul;98(7):1120-7. doi: 10.1111/j.1349-7006.2007.00486.x. Epub 2007 Apr 23.
• [3] The association between adiponectin (+45T/G) and adiponectin receptor-2 (+795G/A) single nucleotide polymorphisms with cirrhosis in Iranian population.Mol Biol Rep. 2012 Mar;39(3):3219-23. doi: 10.1007/s11033-011-1089-3. Epub 2011 Jun 25.
• [4] Adiponectin and leptin receptors expression in Barrett's esophagus and normal squamous epithelium in relation to central obesity status.J Physiol Pharmacol. 2013 Apr;64(2):193-9.
• [5] Expression of AdipoR1 and AdipoR2 Receptors as Leptin-Breast Cancer Regulation Mechanisms.Dis Markers. 2017;2017:4862016. doi: 10.1155/2017/4862016. Epub 2017 Sep 5.
• [6] Demonstration of adiponectin receptors 1 and 2 mRNA expression in human breast cancer cells.Cancer Lett. 2007 Jun 8;250(2):229-36. doi: 10.1016/j.canlet.2006.10.006. Epub 2006 Nov 22.
• [7] Association between adiponectin receptor 2 gene polymorphisms and cerebral infarction.Genet Mol Res. 2014 Sep 26;13(3):7808-14. doi: 10.4238/2014.September.26.19.
• [8] Changes of adiponectin and its receptors in rats following chronic renal failure.Ren Fail. 2014 Feb;36(1):92-7. doi: 10.3109/0886022X.2013.830975. Epub 2013 Sep 13.
• [9] Expression of adiponectin receptors, AdipoR1 and AdipoR2, in normal colon epithelium and colon cancer tissue.Oncol Rep. 2008 Sep;20(3):479-83.
• [10] Associations of adiponectin receptor 2 (AdipoR2) gene polymorphisms and AdipoR2 protein expression levels with the risk of colorectal cancer: A case-control study.Mol Med Rep. 2017 Oct;16(4):3983-3993. doi: 10.3892/mmr.2017.7115. Epub 2017 Jul 31.
• [11] MicroRNA-150 inhibits expression of adiponectin receptor 2 and is a potential therapeutic target in patients with chronic heart failure.J Heart Lung Transplant. 2014 Mar;33(3):252-60. doi: 10.1016/j.healun.2013.10.014. Epub 2013 Oct 12.
• [12] Genetic variation in the adiponectin receptor 2 (ADIPOR2) gene is associated with coronary artery disease and increased ADIPOR2 expression in peripheral monocytes.Cardiovasc Diabetol. 2010 Feb 23;9:10. doi: 10.1186/1475-2840-9-10.
• [13] Modifier gene study of meconium ileus in cystic fibrosis: statistical considerations and gene mapping results.Hum Genet. 2009 Dec;126(6):763-78. doi: 10.1007/s00439-009-0724-8.
• [14] Inducible overexpression of adiponectin receptors highlight the roles of adiponectin-induced ceramidase signaling in lipid and glucose homeostasis.Mol Metab. 2017 Jan 12;6(3):267-275. doi: 10.1016/j.molmet.2017.01.002. eCollection 2017 Mar.
• [15] Adiponectin as novel regulator of cell proliferation in human glioblastoma.J Cell Physiol. 2014 Oct;229(10):1444-54. doi: 10.1002/jcp.24582.
• [16] Maternal intake of grape seed procyanidins during lactation induces insulin resistance and an adiponectin resistance-like phenotype in rat offspring.Sci Rep. 2017 Oct 3;7(1):12573. doi: 10.1038/s41598-017-12597-9.
• [17] Susceptibility of multiple polymorphisms in ADIPOQ, ADIPOR1 and ADIPOR2 genes to myocardial infarction in Han Chinese.Gene. 2018 Jun 5;658:10-17. doi: 10.1016/j.gene.2018.03.022. Epub 2018 Mar 7.
• [18] Human renal adipose tissue induces the invasion and progression of renal cell carcinoma.Oncotarget. 2017 Oct 9;8(55):94223-94234. doi: 10.18632/oncotarget.21666. eCollection 2017 Nov 7.
• [19] Adiponectin inhibits migration and invasion by reversing epithelialmesenchymal transition in nonsmall cell lung carcinoma.Oncol Rep. 2018 Sep;40(3):1330-1338. doi: 10.3892/or.2018.6523. Epub 2018 Jun 25.
• [20] Adiponectin receptor 1 mediates the difference in adiponectin- induced prostaglandin E2 production in rheumatoid arthritis and osteoarthritis synovial fibroblasts.Chin Med J (Engl). 2011 Dec;124(23):3919-24.
• [21] Expression of adiponectin and its receptors is altered in epithelial ovarian tumors and ascites-derived ovarian cancer cell lines.Int J Gynecol Cancer. 2015 Mar;25(3):399-406. doi: 10.1097/IGC.0000000000000369.
• [22] The regulation of adiponectin receptors in human prostate cancer cell lines.Biochem Biophys Res Commun. 2006 Sep 29;348(3):832-8. doi: 10.1016/j.bbrc.2006.07.139. Epub 2006 Jul 31.
• [23] Adiponectin receptor 1 gene (ADIPOR1) variant is associated with advanced age-related macular degeneration in Finnish population.Neurosci Lett. 2012 Apr 4;513(2):233-7. doi: 10.1016/j.neulet.2012.02.050. Epub 2012 Feb 25.
• [24] In silico analysis of nonsynonymous single nucleotide polymorphisms of the human adiponectin receptor 2 (ADIPOR2) gene.Comput Biol Chem. 2017 Jun;68:175-185. doi: 10.1016/j.compbiolchem.2017.03.005. Epub 2017 Mar 14.
• [25] Adiponectin oligomerization state and adiponectin receptors airway expression in chronic obstructive pulmonary disease.Int J Biochem Cell Biol. 2012 Mar;44(3):563-9. doi: 10.1016/j.biocel.2011.12.016. Epub 2012 Jan 3.
• [26] Adiponectin receptor expression is elevated in colorectal carcinomas but not in gastrointestinal stromal tumors.Endocr Relat Cancer. 2008 Mar;15(1):289-99. doi: 10.1677/ERC-07-0197.
• [27] Adiponectin Receptor gene Polymorphisms are Associated with Kidney Function in Elderly Japanese Populations.J Atheroscler Thromb. 2019 Apr 1;26(4):328-339. doi: 10.5551/jat.45609. Epub 2018 Aug 22.
• [28] Adiponectin and leptin systems in human endometrium during window of implantation.Fertil Steril. 2012 Mar;97(3):771-8.e1. doi: 10.1016/j.fertnstert.2011.12.042. Epub 2012 Jan 21.
• [29] Adiponectin and its receptors are involved in hypertensive vascular injury.Mol Med Rep. 2018 Jan;17(1):209-215. doi: 10.3892/mmr.2017.7878. Epub 2017 Oct 25.
• [30] Role of adiponectin/peroxisome proliferator-activated receptor alpha signaling in human chorionic gonadotropin-induced estradiol synthesis in human luteinized granulosa cells.Mol Cell Endocrinol. 2019 Aug 1;493:110450. doi: 10.1016/j.mce.2019.110450. Epub 2019 May 19.
• [31] Common polymorphisms in the adiponectin and its receptor genes, adiponectin levels and the risk of prostate cancer.Cancer Epidemiol Biomarkers Prev. 2011 Dec;20(12):2618-27. doi: 10.1158/1055-9965.EPI-11-0434. Epub 2011 Sep 29.
• [32] Adiponectin and PPAR: a setup for intricate crosstalk between obesity and non-alcoholic fatty liver disease.Rev Endocr Metab Disord. 2019 Sep;20(3):253-261. doi: 10.1007/s11154-019-09510-2.
• [33] Adiponectin and adiponectin receptor in relation to colorectal cancer progression.Int J Cancer. 2010 Dec 15;127(12):2758-67. doi: 10.1002/ijc.25301.
• [34] miR-449a induces EndMT, promotes the development of atherosclerosis by targeting the interaction between AdipoR2 and E-cadherin in Lipid Rafts.Biomed Pharmacother. 2019 Jan;109:2293-2304. doi: 10.1016/j.biopha.2018.11.114. Epub 2018 Nov 28.
• [35] The Adiponectin-AdipoR1 Axis Mediates Tumor Progression and Tyrosine Kinase Inhibitor Resistance in Metastatic Renal Cell Carcinoma.Neoplasia. 2019 Sep;21(9):921-931. doi: 10.1016/j.neo.2019.07.004. Epub 2019 Aug 8.
• [36] Are decreased AdipoR1 mRNA levels associated with adiponectin resistance in coronary artery disease patients?.Clin Exp Pharmacol Physiol. 2015 Apr;42(4):331-6. doi: 10.1111/1440-1681.12361.
• [37] Involvement of adiponectin and leptin in breast cancer: clinical and in vitro studies.Endocr Relat Cancer. 2009 Dec;16(4):1197-210. doi: 10.1677/ERC-09-0043. Epub 2009 Aug 6.
• [38] Maternal docosahexaenoic acid increases adiponectin and normalizes IUGR-induced changes in rat adipose deposition.J Obes. 2013;2013:312153. doi: 10.1155/2013/312153. Epub 2013 Mar 6.
• [39] Expression of adiponectin and its receptors in type 1 diabetes mellitus in human and mouse retinas.Mol Vis. 2013 Aug 4;19:1769-78. Print 2013.
• [40] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [41] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [42] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [43] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [44] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [45] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [46] Regulation of adiponectin receptors in hepatocytes by the peroxisome proliferator-activated receptor-gamma agonist rosiglitazone. Diabetologia. 2006 Jun;49(6):1303-10. doi: 10.1007/s00125-006-0228-1. Epub 2006 Apr 12.
• [47] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [48] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [49] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [50] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [51] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [52] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [53] Adiponectin attenuates lung fibroblasts activation and pulmonary fibrosis induced by paraquat. PLoS One. 2015 May 6;10(5):e0125169. doi: 10.1371/journal.pone.0125169. eCollection 2015.
• [54] Genome-wide mapping for clinically relevant predictors of lamotrigine- and phenytoin-induced hypersensitivity reactions. Pharmacogenomics. 2012 Mar;13(4):399-405. doi: 10.2217/pgs.11.165.