Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6X8G5T)

• DOT Name: Interferon-induced GTP-binding protein Mx1 (MX1)
• Synonyms: Interferon-induced protein p78; IFI-78K; Interferon-regulated resistance GTP-binding protein MxA; Myxoma resistance protein 1; Myxovirus resistance protein 1
• Gene Name: MX1
• Related Disease:
  Chronic progressive multiple sclerosis
  Neoplasm
  Prostate cancer
  Prostate carcinoma
  Acute myelogenous leukaemia
  Alopecia
  Alopecia areata
  Alzheimer disease
  Anti-neutrophil cytoplasmic antibody-associated vasculitis
  Cryohydrocytosis
  Dermatomyositis
  Fanconi's anemia
  Glioma
  Hepatitis B virus infection
  Herpes simplex infection
  High blood pressure
  HSD10 mitochondrial disease
  IgA nephropathy
  Influenza
  Lupus nephritis
  Measles
  Melanoma
  Metastatic melanoma
  Multiple sclerosis
  Myocardial ischemia
  Non-syndromic ichthyosis
  Polymyalgia rheumatica
  Severe acute respiratory syndrome (SARS)
  Systemic lupus erythematosus
  Systemic sclerosis
  Ulcer
  Rheumatoid arthritis
  Advanced cancer
  Gastric cancer
  Gastric neoplasm
  Hepatitis C virus infection
  Hereditary diffuse gastric adenocarcinoma
• UniProt ID: MX1_HUMAN
• PDB ID: 3LJB; 3SZR; 3ZYS; 4P4S; 4P4T; 4P4U; 5GTM
• Pfam ID: PF01031 ; PF00350 ; PF02212
• Sequence:
  MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLR
  ALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKW
  RGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLP
  GITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGD
  RTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREK
  IFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKY
  GVDIPEDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIEN
  NFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMV
  RLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRG
  ALQKVREKELEEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLII
  QFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQF
  PG
• Function: Interferon-induced dynamin-like GTPase with antiviral activity against a wide range of RNA viruses and some DNA viruses. Its target viruses include negative-stranded RNA viruses and HBV through binding and inactivation of their ribonucleocapsid. May also antagonize reoviridae and asfarviridae replication. Inhibits thogoto virus (THOV) replication by preventing the nuclear import of viral nucleocapsids. Inhibits La Crosse virus (LACV) replication by sequestering viral nucleoprotein in perinuclear complexes, preventing genome amplification, budding, and egress. Inhibits influenza A virus (IAV) replication by decreasing or delaying NP synthesis and by blocking endocytic traffic of incoming virus particles. Enhances ER stress-mediated cell death after influenza virus infection. May regulate the calcium channel activity of TRPCs.
• KEGG Pathway:
  Viral life cycle - HIV-1 (hsa03250)
  Hepatitis C (hsa05160)
  Measles (hsa05162)
  Influenza A (hsa05164)
  Human papillomavirus infection (hsa05165)
  Coro.virus disease - COVID-19 (hsa05171)
• Reactome Pathway:
  Interferon alpha/beta signaling (R-HSA-909733)
  ISG15 antiviral mechanism (R-HSA-1169408)

Molecular Interaction Atlas (MIA) of This DOT

37 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Chronic progressive multiple sclerosis	DIS9JZ35	Definitive	Altered Expression	[1]
Neoplasm	DISZKGEW	Definitive	Altered Expression	[2]
Prostate cancer	DISF190Y	Definitive	Altered Expression	[3]
Prostate carcinoma	DISMJPLE	Definitive	Altered Expression	[3]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[4]
Alopecia	DIS37HU4	Strong	Biomarker	[5]
Alopecia areata	DIS0XXBJ	Strong	Biomarker	[5]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[6]
Anti-neutrophil cytoplasmic antibody-associated vasculitis	DISBEQIT	Strong	Biomarker	[7]
Cryohydrocytosis	DISMQHL3	Strong	Genetic Variation	[8]
Dermatomyositis	DIS50C5O	Strong	Altered Expression	[9]
Fanconi's anemia	DISGW6Q8	Strong	Biomarker	[10]
Glioma	DIS5RPEH	Strong	Biomarker	[11]
Hepatitis B virus infection	DISLQ2XY	Strong	Genetic Variation	[12]
Herpes simplex infection	DISL1SAV	Strong	Altered Expression	[13]
High blood pressure	DISY2OHH	Strong	Altered Expression	[14]
HSD10 mitochondrial disease	DISCJYFW	Strong	Altered Expression	[15]
IgA nephropathy	DISZ8MTK	Strong	Biomarker	[7]
Influenza	DIS3PNU3	Strong	Biomarker	[16]
Lupus nephritis	DISCVGPZ	Strong	Altered Expression	[7]
Measles	DISXSUID	Strong	Biomarker	[17]
Melanoma	DIS1RRCY	Strong	Biomarker	[18]
Metastatic melanoma	DISSL43L	Strong	Genetic Variation	[18]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[19]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[20]
Non-syndromic ichthyosis	DISZ9QBQ	Strong	Biomarker	[21]
Polymyalgia rheumatica	DIS5F36E	Strong	Altered Expression	[22]
Severe acute respiratory syndrome (SARS)	DISYW14W	Strong	Genetic Variation	[23]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[7]
Systemic sclerosis	DISF44L6	Strong	Altered Expression	[24]
Ulcer	DISHF2X6	Strong	Altered Expression	[24]
Rheumatoid arthritis	DISTSB4J	Disputed	Biomarker	[25]
Advanced cancer	DISAT1Z9	Limited	Genetic Variation	[26]
Gastric cancer	DISXGOUK	Limited	Biomarker	[27]
Gastric neoplasm	DISOKN4Y	Limited	Biomarker	[27]
Hepatitis C virus infection	DISQ0M8R	Limited	Genetic Variation	[8]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Limited	Biomarker	[27]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitomycin	DMH0ZJE	Approved	Interferon-induced GTP-binding protein Mx1 (MX1) increases the response to substance of Mitomycin.	[10]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[28]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[29]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[30]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[31]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[32]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[33]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[34]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[35]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[36]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[37]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[38]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[27]
Selenium	DM25CGV	Approved	Selenium increases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[40]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[41]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[38]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[42]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[43]
Diclofenac	DMPIHLS	Approved	Diclofenac decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[38]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[38]
Lucanthone	DMZLBUO	Approved	Lucanthone increases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[44]
Prednisolone	DMQ8FR2	Approved	Prednisolone decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[38]
Methylprednisolone	DM4BDON	Approved	Methylprednisolone decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[38]
Tofacitinib	DMBS370	Approved	Tofacitinib decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[45]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[46]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[47]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[40]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[49]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[51]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[52]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[53]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde decreases the expression of Interferon-induced GTP-binding protein Mx1 (MX1).	[54]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Interferon-induced GTP-binding protein Mx1 (MX1).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Interferon-induced GTP-binding protein Mx1 (MX1).	[50]

References

• [1] MxA protein--an interferon beta biomarker in primary progressive multiple sclerosis patients.Eur J Neurol. 2008 Aug;15(8):822-6. doi: 10.1111/j.1468-1331.2008.02190.x. Epub 2008 Jun 28.
• [2] Alpha-interferon secreting blastic plasmacytoid dendritic cells neoplasm: a case report with histological, molecular genetics and long-term tumor cells culture studies.Am J Dermatopathol. 2012 Aug;34(6):626-31. doi: 10.1097/DAD.0b013e31824d689c.
• [3] Interferon inducible antiviral MxA is inversely associated with prostate cancer and regulates cell cycle, invasion and Docetaxel induced apoptosis.Prostate. 2015 Feb 15;75(3):266-79. doi: 10.1002/pros.22912. Epub 2014 Oct 18.
• [4] Discovery of epigenetically silenced genes in acute myeloid leukemias.Leukemia. 2007 May;21(5):1026-34. doi: 10.1038/sj.leu.2404611. Epub 2007 Mar 1.
• [5] Structure and polymorphism of the human gene for the interferon-induced p78 protein (MX1): evidence of association with alopecia areata in the Down syndrome region.Hum Genet. 2000 Jun;106(6):639-45. doi: 10.1007/s004390000318.
• [6] MxA polymorphisms are associated with risk and age-at-onset in Alzheimer disease and accelerated cognitive decline in Chinese elders.Rejuvenation Res. 2012 Oct;15(5):516-22. doi: 10.1089/rej.2012.1328. Epub 2012 Sep 21.
• [7] Interferon-inducible Mx1 protein is highly expressed in renal tissues from treatment-nave lupus nephritis, but not in those under immunosuppressive treatment.Mod Rheumatol. 2018 Jul;28(4):661-669. doi: 10.1080/14397595.2017.1404711. Epub 2017 Nov 30.
• [8] Influence of IL28B and MxA gene polymorphisms on HCV clearance in Han Chinese population.Epidemiol Infect. 2018 Feb;146(3):379-385. doi: 10.1017/S0950268817002928. Epub 2017 Dec 22.
• [9] Glomerular expression of myxovirus resistance protein 1 in human mesangial cells: possible activation of innate immunity in the pathogenesis of lupus nephritis.Nephrology (Carlton). 2013 Dec;18(12):833-7. doi: 10.1111/nep.12155.
• [10] MxA overexpression reveals a common genetic link in four Fanconi anemia complementation groups. J Clin Invest. 1997 Dec 1;100(11):2873-80. doi: 10.1172/JCI119836.
• [11] Grade II/III Glioma Microenvironment Mining and Its Prognostic Merit.World Neurosurg. 2019 Dec;132:e76-e88. doi: 10.1016/j.wneu.2019.08.253. Epub 2019 Sep 10.
• [12] Myxovirus resistance 1 gene polymorphisms and outcomes of viral hepatitis B and C infections in Moroccan patients.J Med Virol. 2017 Apr;89(4):647-652. doi: 10.1002/jmv.24642. Epub 2016 Dec 26.
• [13] Establishment and characterization of an immortalized renal cell line of the Chinese tree shrew (Tupaia belangeri chinesis).Appl Microbiol Biotechnol. 2019 Mar;103(5):2171-2180. doi: 10.1007/s00253-019-09615-3. Epub 2019 Jan 12.
• [14] Expression of interferon inducible genes following Hantaan virus infection as a mechanism of resistance in A549 cells.Virus Genes. 2003 Jan;26(1):31-8. doi: 10.1023/a:1022373904357.
• [15] A type I interferon signature characterizes chronic antibody-mediated rejection in kidney transplantation.J Pathol. 2015 Sep;237(1):72-84. doi: 10.1002/path.4553. Epub 2015 Jun 4.
• [16] Anti-Influenza A Virus Activities of Type I/III Interferons-Induced Mx1 GTPases from Different Mammalian Species.J Interferon Cytokine Res. 2019 May;39(5):274-282. doi: 10.1089/jir.2018.0157. Epub 2019 Apr 2.
• [17] Functional MxA promoter polymorphism associated with subacute sclerosing panencephalitis.Neurology. 2004 Feb 10;62(3):457-60. doi: 10.1212/01.wnl.0000106940.95749.8e.
• [18] Upregulation of intratumoral HLA class I and peritumoral Mx1 in ulcerated melanomas.Oncoimmunology. 2019 Sep 6;8(11):e1660121. doi: 10.1080/2162402X.2019.1660121. eCollection 2019.
• [19] Myxovirus resistance protein A (MxA) polymorphism is associated with IFN response in Iranian multiple sclerosis patients.Neurol Sci. 2017 Jun;38(6):1093-1099. doi: 10.1007/s10072-017-2935-4. Epub 2017 Apr 6.
• [20] Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
• [21] Disruption of Supv3L1 damages the skin and causes sarcopenia, loss of fat, and death.Mamm Genome. 2009 Feb;20(2):92-108. doi: 10.1007/s00335-008-9168-z. Epub 2009 Jan 15.
• [22] Expression of the class I interferon-related MxA protein in temporal arteries in polymyalgia rheumatica and temporal arteritis.Scand J Rheumatol. 2009 Mar-Apr;38(2):144-8. doi: 10.1080/03009740802448841.
• [23] Significance of the myxovirus resistance A (MxA) gene -123C>a single-nucleotide polymorphism in suppressed interferon beta induction of severe acute respiratory syndrome coronavirus infection.J Infect Dis. 2010 Jun 15;201(12):1899-908. doi: 10.1086/652799.
• [24] Upregulation of myxovirus-resistance protein A: a possible marker of type I interferon induction in systemic sclerosis.J Rheumatol. 2008 Nov;35(11):2192-200. doi: 10.3899/jrheum.080418. Epub 2008 Oct 1.
• [25] Heterogeneity of the Type I Interferon Signature in Rheumatoid Arthritis: A Potential Limitation for Its Use As a Clinical Biomarker.Front Immunol. 2018 Jan 16;8:2007. doi: 10.3389/fimmu.2017.02007. eCollection 2017.
• [26] Structural analysis of tumor-related single amino acid mutations in human MxA protein.Chin J Cancer. 2015 Sep 28;34(12):583-93. doi: 10.1186/s40880-015-0055-1.
• [27] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
• [28] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [29] Evaluation of a human iPSC-derived BBB model for repeated dose toxicity testing with cyclosporine A as model compound. Toxicol In Vitro. 2021 Jun;73:105112. doi: 10.1016/j.tiv.2021.105112. Epub 2021 Feb 22.
• [30] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [31] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [32] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [33] Molecular mechanism of action of bisphenol and bisphenol A mediated by oestrogen receptor alpha in growth and apoptosis of breast cancer cells. Br J Pharmacol. 2013 May;169(1):167-78.
• [34] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [35] Proteomic and functional analyses reveal a dual molecular mechanism underlying arsenic-induced apoptosis in human multiple myeloma cells. J Proteome Res. 2009 Jun;8(6):3006-19.
• [36] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [37] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [38] Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
• [39] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
• [40] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [41] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [42] Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
• [43] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [44] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [45] White-to-brown metabolic conversion of human adipocytes by JAK inhibition. Nat Cell Biol. 2015 Jan;17(1):57-67. doi: 10.1038/ncb3075. Epub 2014 Dec 8.
• [46] Integrated transcriptomic and metabolomic analyses to characterize the anti-cancer effects of (-)-epigallocatechin-3-gallate in human colon cancer cells. Toxicol Appl Pharmacol. 2020 Aug 15;401:115100. doi: 10.1016/j.taap.2020.115100. Epub 2020 Jun 6.
• [47] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [48] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [49] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [50] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [51] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [52] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [53] CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
• [54] Comparative DNA microarray analysis of human monocyte derived dendritic cells and MUTZ-3 cells exposed to the moderate skin sensitizer cinnamaldehyde. Toxicol Appl Pharmacol. 2009 Sep 15;239(3):273-83.
• [55] MxA overexpression reveals a common genetic link in four Fanconi anemia complementation groups. J Clin Invest. 1997 Dec 1;100(11):2873-80. doi: 10.1172/JCI119836.